KEGG   Homo sapiens (human): 219956Help
Entry
219956            CDS       T01001                                 

Gene name
OR9Q1
Definition
(RefSeq) olfactory receptor family 9 subfamily Q member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    219956 (OR9Q1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    219956 (OR9Q1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    219956 (OR9Q1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 219956
NCBI-ProteinID: NP_001005212
HGNC: 14724
Ensembl: ENSG00000186509
Vega: OTTHUMG00000167413
Pharos: Q8NGQ5(Tdark)
UniProt: Q8NGQ5
Position
11q12.1
AA seq 310 aa AA seqDB search
MAEMNLTLVTEFLLIAFTEYPEWALPLFLLFLFMYLITVLGNLEMIILILMDHQLHAPMY
FLLSHLAFMDVCYSSITVPQMLAVLLEHGAALSYTRCAAQFFLFTFFGSIDCYLLALMAY
DRYLAVCQPLLYVTILTQQARLSLVAGAYVAGLISALVRTVSAFTLSFCGTSEIDFIFCD
LPPLLKLTCGESYTQEVLIIMFAIFVIPASMVVILVSYLFIIVAIMGIPAGSQAKTFSTC
TSHLTAVSLFFGTLIFMYLRGNSDQSSEKNRVVSVLYTEVIPMLNPLIYSLRNKEVKEAL
RKILNRAKLS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggcagagatgaacctcaccttggtgaccgagttcctccttattgcattcactgaatat
cctgaatgggcactccctctcttcctcttgtttttatttatgtatctcatcaccgtattg
gggaacttagagatgattattctgatcctcatggatcaccagctccacgctccaatgtat
ttccttctgagtcacctcgctttcatggacgtctgctactcatctatcactgtcccccag
atgctggcagtgctgctggagcatggggcagctttatcttacacacgctgtgctgctcag
ttctttctgttcaccttctttggttccatcgactgctacctcttggccctcatggcctat
gaccgctacttggctgtgtgccagcccctgctttatgtcaccatcctgacacagcaggcc
cgcttgagtcttgtggctggggcttacgttgctggtctcatcagtgccttggtgcggaca
gtctcagccttcactctctccttctgtggaaccagtgagattgactttattttctgtgac
ctccctcctctgttaaagttgacctgtggggagagctacactcaagaagtgctgattatt
atgtttgccatttttgtcatccctgcttccatggtggtgatcttggtgtcctacctgttt
atcatcgtggccatcatggggatccctgctggaagccaggccaagaccttctccacctgc
acctcccacctcactgctgtgtcactcttctttggtaccctcatcttcatgtacttgaga
ggtaactcagatcagtcttcggagaagaatcgggtagtgtctgtgctttacacagaggtc
atccccatgttgaatcccctcatctacagcctgaggaacaaggaagtgaaggaggccctg
agaaaaattctcaatagagccaagttgtcctaa

DBGET integrated database retrieval system