KEGG   Homo sapiens (human): 219958Help
Entry
219958            CDS       T01001                                 

Gene name
OR1S2, OR11-231
Definition
(RefSeq) olfactory receptor family 1 subfamily S member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    219958 (OR1S2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    219958 (OR1S2)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    219958 (OR1S2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 219958
NCBI-ProteinID: NP_001004459
HGNC: 15141
Ensembl: ENSG00000197887
Vega: OTTHUMG00000167541
Pharos: Q8NGQ3(Tdark)
UniProt: Q8NGQ3
Position
11q12.1
AA seq 325 aa AA seqDB search
MKTLCSFLQISRNMHQENQTTITEFILLGLSNQAEHQNLLFVLFLSMYVVTVVGNGLIIV
AISLDIYLHTPMYLFLAYLSFADISSISNSVPKMLVNIQTNSQSISYESCITQMYFSIVF
VVTDNLLLGTMAFDHFVAICHPLNYTTFMRARFGTLLTVISWFLSNIIALTHTLLLIQLL
FCDHNTLPHFFCDLAPLLKLSCSDTMINELVLFIVGLSVIIFPFVLIFFSYVCIIRAVLG
VSSTQGKWKAFSTCGSHLTIALLFYGTTVGVYFFPSSTHPEDTDKIGAVLFTVVTPMMNP
FIYSLRNKDMKGALRKLINRKISSL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaagactttgtgttcctttcttcagatcagcagaaatatgcatcaagaaaaccaaacc
accatcactgaattcattctcctgggactctccaaccaggctgaacatcaaaacctcctc
tttgtgcttttcctgagtatgtatgtggtcactgtggttgggaacgggctcatcattgtg
gctatcagcttggatatataccttcacacccccatgtatctcttccttgcctacctatcc
tttgctgatatttcctccatttccaactcagtccccaaaatgctggtgaatattcaaacc
aacagccaatccatctcttatgagagctgcatcacacagatgtacttttctattgtgttt
gtcgtcactgacaatttgcttttggggaccatggccttcgaccactttgtggcgatctgc
caccctctgaactatacaactttcatgcgggccaggttcggcactttgctcacagtcatc
tcgtggttcctcagtaatattattgctcttacacacacccttctgctcattcaattgctc
ttctgtgaccacaacactctcccacacttcttctgtgacttggcccctctgctcaaactg
tcctgttcagatacaatgatcaatgagcttgtgttgtttattgtgggtttatcagttatc
atcttcccctttgtactcatcttcttctcctatgtctgcatcatcagagctgtcctggga
gtatcatccacacagggaaagtggaaagccttctccacttgtggctctcacctgacaatt
gcattactgttctacggaaccactgtaggcgtgtactttttcccctcctccactcaccct
gaggacactgataagattggtgctgtcctattcactgtggtgacacccatgatgaacccc
ttcatctacagcttgaggaataaggatatgaaaggtgccctgagaaagctcatcaataga
aaaatttcttccctttga

DBGET integrated database retrieval system