KEGG   Homo sapiens (human): 219982Help
Entry
219982            CDS       T01001                                 

Gene name
OR5A1, OR11-249, OR5A1P, OST181
Definition
(RefSeq) olfactory receptor family 5 subfamily A member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    219982 (OR5A1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    219982 (OR5A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 219982
NCBI-ProteinID: NP_001004728
HGNC: 8319
Ensembl: ENSG00000172320
Vega: OTTHUMG00000167339
Pharos: Q8NGJ0(Tdark)
UniProt: Q8NGJ0
Position
11q12.1
AA seq 315 aa AA seqDB search
MSITKAWNSSSVTMFILLGFTDHPELQALLFVTFLGIYLTTLAWNLALIFLIRGDTHLHT
PMYFFLSNLSFIDICYSSAVAPNMLTDFFWEQKTISFVGCAAQFFFFVGMGLSECLLLTA
MAYDRYAAISSPLLYPTIMTQGLCTRMVVGAYVGGFLSSLIQASSIFRLHFCGPNIINHF
FCDLPPVLALSCSDTFLSQVVNFLVVVTVGGTSFLQLLISYGYIVSAVLKIPSAEGRWKA
CNTCASHLMVVTLLFGTALFVYLRPSSSYLLGRDKVVSVFYSLVIPMLNPLIYSLRNKEI
KDALWKVLERKKVFS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtccataaccaaagcctggaacagctcatcagtgaccatgttcatcctcctgggattc
acagaccatccagaactccaggccctcctctttgtgaccttcctgggcatctatcttacc
accctggcctggaacctggccctcatttttctgatcagaggtgacacccatctgcacaca
cccatgtacttcttcctaagcaacttatctttcattgacatctgctactcttctgctgtg
gctcccaatatgctcactgacttcttctgggagcagaagaccatatcatttgtgggctgt
gctgctcagttttttttctttgtcggcatgggtctgtctgagtgcctcctcctgactgct
atggcatacgaccgatatgcagccatctccagcccccttctctaccccactatcatgacc
cagggcctctgtacacgcatggtggttggggcatatgttggtggcttcctgagctccctg
atccaggccagctccatatttaggcttcacttttgcggacccaacatcatcaaccacttc
ttctgcgacctcccaccagtcctggctctgtcttgctctgacaccttcctcagtcaagtg
gtgaatttcctcgtggtggtcactgtcggaggaacatcgttcctccaactccttatctcc
tatggttacatagtgtctgcggtcctgaagatcccttcagcagagggccgatggaaagcc
tgcaacacgtgtgcctcgcatctgatggtggtgactctgctgtttgggacagcccttttc
gtgtacttgcgacccagctccagctacttgctaggcagggacaaggtggtgtctgttttc
tattcattggtgatccccatgctgaaccctctcatttacagtttgaggaacaaagagatc
aaggatgccctgtggaaggtgttggaaaggaagaaagtgttttcttag

DBGET integrated database retrieval system