KEGG   Homo sapiens (human): 219986Help
Entry
219986            CDS       T01001                                 

Gene name
OR4D11, OR4D11P
Definition
(RefSeq) olfactory receptor family 4 subfamily D member 11
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    219986 (OR4D11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    219986 (OR4D11)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    219986 (OR4D11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 219986
NCBI-ProteinID: NP_001004706
HGNC: 15174
Ensembl: ENSG00000176200
Vega: OTTHUMG00000167342
Pharos: Q8NGI4(Tdark)
UniProt: Q8NGI4 A0A126GVQ9
Position
11q12.1
AA seq 311 aa AA seqDB search
MELGNVTRVKEFIFLGLTQSQDQSLVLFLFLCLVYMTTLLGNLLIMVTVTCESRLHTPMY
FLLRNLAILDICFSSTTAPKVLLDLLSKKKTISYTSCMTQIFLFHLLGGADIFSLSVMAF
DCYMAISKPLHYVTIMSRGQCTALISASWMGGFVHSIVQISLLLPLPFCGPNVLDTFYCD
VPQVLKLTCTDTFALEFLMISNNGLVTTLWFIFLLVSYTVILMTLRSQAGGGRRKAISTC
TSHITVVTLHFVPCIYVYARPFTALPTEKAISVTFTVISPLLNPLIYTLRNQEMKSAMRR
LKRRLVPSERE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggagttgggaaatgtcaccagagtaaaagaatttatatttctgggacttactcaatcc
caagaccagagtttggtcttgtttctttttttatgtcttgtgtacatgacgactctgctg
ggaaacctcctcatcatggtcaccgtgacctgtgagtctcgccttcacacccccatgtac
ttcctgctccgcaatctagccatccttgacatctgcttctcctccacaactgctcctaaa
gtcttgctggaccttctgtcaaagaaaaagaccatatcctatacaagctgcatgacacag
atatttctcttccacctccttggtggggcagacattttttctctctctgtgatggcgttt
gactgctacatggccatctccaagcccctgcactatgtgaccatcatgagtagagggcaa
tgcactgccctcatctctgcctcttggatggggggctttgtccactccatcgtgcagatc
tccctgttgctgcctctccctttctgtggacccaatgttcttgacactttctactgcgat
gtcccccaggtcctcaaactcacttgcactgacacttttgctcttgagttcttgatgatt
tccaacaatggcctggtcactaccctgtggtttatcttcctgcttgtgtcctacacagtc
atcctaatgacgctgaggtctcaggcaggagggggcaggaggaaagccatctccacttgc
acctcccacatcactgtggtgaccctgcattttgtgccctgcatctatgtctatgcccgg
cccttcactgccctccccacagaaaaggccatctctgtcaccttcactgtcatctcccct
ctgctgaaccctttgatctacactctgaggaaccaggaaatgaagtcagccatgagaaga
ctgaagagaagactcgtgccttctgaaagggaatag

DBGET integrated database retrieval system