KEGG   Homo sapiens (human): 219990
Entry
219990            CDS       T01001                                 
Symbol
OOSP2, OOSP2A, PLAC1L, TMEM122
Name
(RefSeq) oocyte secreted protein 2
  KO
K25756  oocyte-secreted protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    219990 (OOSP2)
SSDB
Other DBs
NCBI-GeneID: 219990
NCBI-ProteinID: NP_776162
HGNC: 26699
Ensembl: ENSG00000149507
Pharos: Q86WS3(Tdark)
UniProt: Q86WS3 A0A140VJR6
Position
11:60040409..60048044
AA seq 158 aa
MALEVLMLLAVLIWTGAENLHVKISCSLDWLMVSVIPVAESRNLYIFADELHLGMGCPAN
RIHTYVYEFIYLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVW
LTPVSTENEIKLDPSPFIADFQTTAEELGLLSSSPNLL
NT seq 477 nt   +upstreamnt  +downstreamnt
atggcgttagaagtcttgatgctcctcgctgtcttgatttggaccggtgctgagaacctc
catgtgaaaataagttgctctctggactggttgatggtctcagttatcccagttgcagaa
agcagaaatctgtatatatttgcggatgaattacatctgggaatgggctgccctgcaaat
cggatacatacatatgtatatgagtttatatatcttgttcgtgattgtggcatcaggaca
agggtagtttctgaggaaactctcctttttcaaaccgagctgtactttaccccaaggaat
atagatcatgaccctcaggaaatccatttggagtgttccacctctaggaaatcagtgtgg
cttacaccagtttctactgagaatgaaataaaattggatcctagtccttttattgctgac
tttcagacaacagcagaagagttaggattattatcttctagtccaaacttgctctga

DBGET integrated database retrieval system