KEGG   Homo sapiens (human): 220064
Entry
220064            CDS       T01001                                 
Symbol
LTO1, CIAB1, ORAOV1, TAOS1
Name
(RefSeq) LTO1 maturation factor of ABCE1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Yae1_N PLU-1
Other DBs
NCBI-GeneID: 220064
NCBI-ProteinID: NP_703152
OMIM: 607224
HGNC: 17589
Ensembl: ENSG00000149716
Pharos: Q8WV07(Tbio)
UniProt: Q8WV07 A0A024R5H3
Position
11:complement(69665563..69675353)
AA seq 137 aa
MAGSQDIFDAIVMADERFHGEGYREGYEEGSSLGVMEGRQHGTLHGAKIGSEIGCYQGFA
FAWKCLLHSCTTEKDSRKMKVLESLIGMIQKFPYDDPTYDKLHEDLDKIRGKFKQFCSLL
NVQPDFKISAEGSGLSF
NT seq 414 nt   +upstreamnt  +downstreamnt
atggctggcagtcaggacatattcgatgccatcgtgatggcggatgagaggtttcatggg
gaagggtatcgggaaggctatgaagaaggcagtagtttgggtgtgatggagggaaggcag
catggcacgctgcatggagccaaaatcgggtctgagatcgggtgctaccaaggttttgct
tttgcatggaaatgtctactgcacagttgcaccactgagaaggacagcagaaagatgaag
gtcttagaatcattgattggaatgatccagaaattcccttatgatgaccctacttacgat
aaactccatgaagacttagacaagatcagaggaaaatttaaacagttttgttcgttactc
aatgttcagccagactttaaaattagtgcagaaggttccggactttcattttga

DBGET integrated database retrieval system