KEGG   Homo sapiens (human): 220082Help
Entry
220082            CDS       T01001                                 

Gene name
SPERT, CBY2, NURIT
Definition
(RefSeq) spermatid associated
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Chibby ZapB DUF4407 Na_trans_assoc
Motif
Other DBs
NCBI-GeneID: 220082
NCBI-ProteinID: NP_689932
HGNC: 30720
Ensembl: ENSG00000174015
Vega: OTTHUMG00000016861
Pharos: Q8NA61(Tdark)
UniProt: Q8NA61 A0A140VJV5
Position
13q14.13
AA seq 448 aa AA seqDB search
MSPLECSECFGDQLLHRTYTWQLTLHSRPNYTRKRDTRSESLEIPISVVLPQRGTAEPFP
RLHNLYSTPRCAQQAALPRLSRRMASQHSYPLNRFSSVPLDPMERPMSQADLELDYNPPR
VQLSDEMFVFQDGRWVNENCRLQSPYFSPSASFHHKLHHKRLAKECMLQEENKSLREENK
ALREENRMLSKENKILQVFWEEHKASLGREESRAPSPLLHKDSASLEVVKKDHVALQVPR
GKEDSTLQLLREENRALQQLLEQKQAYWAQAEDTAAPAEESKPAPSPHEEPCSPGLLQDQ
GSGLSSRFEEPKGPPARQEDSKELRALRKMVSNMSGPSGEEEAKVGPGLPDGCQPLQLLR
EMRQALQALLKENRLLQEENRTLQVLRAEHRGFQEENKALWENNKLKLQQKLVIDTVTEV
TARMEMLIEELYAFMPARSQDPKKPSRV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtcacctctggaatgttctgagtgttttggtgaccaacttctgcataggacctatacc
tggcaactcacattgcactcaaggccaaattatacaagaaaaagagataccagatctgaa
agcctagaaattccaatcagtgtggttctacctcagaggggcacagccgaacccttcccg
aggctccacaacttgtacagcacccctcgctgcgcgcagcaggccgccctgccccggctg
agccgcaggatggcgagccagcactcctatccactgaaccgcttctcctccgtgccttta
gaccccatggagcgccccatgtcccaggccgacctggagctggactacaacccgccgcgg
gtgcagctcagcgacgagatgttcgtgttccaggacgggcgctgggtaaatgagaactgc
cgcctgcagtctccctacttctccccatccgcctccttccaccacaagctgcaccacaag
aggctggccaaggagtgcatgctgcaggaggagaacaagtctctgcgggaggagaacaag
gccctgcgcgaggagaaccggatgctcagcaaggagaacaagatcctacaggtcttctgg
gaggagcacaaggcctcgctgggccgagaggagagccgggccccctcgccactgctgcac
aaagacagcgcgtccctggaggtggtgaagaaggaccacgtcgccctgcaggtgccccgt
ggcaaggaggacagcaccctgcagctcctccgggaggagaatcgcgcgctgcagcagctg
ctggagcagaaacaggcctactgggcgcaggcagaggacacggccgcccctgccgaggaa
agcaagcccgccccctcaccccacgaggagccctgcagccccgggctgctgcaggaccag
ggctccggcctctcctcccgcttcgaggagcccaaagggcctccggcccggcaggaggac
tccaaggagctgcgcgccctgcggaagatggtcagcaacatgtccgggccctccggggag
gaggaggccaaggtgggcccgggcctgcccgacggctgccagcccctgcagctgctgaga
gagatgaggcaggcgctgcaggccctgctcaaggagaaccggctcctgcaggaggagaac
aggaccctgcaggtgctacgggcagagcacaggggcttccaggaggagaacaaggccctg
tgggagaacaacaagctgaagctgcagcagaagctggtcattgacaccgtgaccgaggtc
accgcgcgcatggaaatgctcatcgaggagctctacgccttcatgccggccaggagccag
gaccccaagaagcctagcagggtctga

DBGET integrated database retrieval system