KEGG   Homo sapiens (human): 2201Help
Entry
2201              CDS       T01001                                 

Gene name
FBN2, CCA, DA9, EOMD
Definition
(RefSeq) fibrillin 2
  KO
K23342  fibrillin 2/3
Organism
hsa  Homo sapiens (human)
Disease
H00660  Congenital contractural arachnodactyly
H00811  Distal arthrogryposis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2201 (FBN2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   2201 (FBN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF_CA cEGF TB EGF FXa_inhibition hEGF EGF_3 Fibrillin_U_N Cadherin
Motif
Other DBs
NCBI-GeneID: 2201
NCBI-ProteinID: NP_001990
OMIM: 612570
HGNC: 3604
Ensembl: ENSG00000138829
Vega: OTTHUMG00000163082
Pharos: P35556(Tbio)
UniProt: P35556
Position
5q23.3
AA seq 2912 aa AA seqDB search
MGRRRRLCLQLYFLWLGCVVLWAQGTAGQPQPPPPKPPRPQPPPQQVRSATAGSEGGFLA
PEYREEGAAVASRVRRRGQQDVLRGPNVCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCG
DGFCSRPNMCTCSSGQISSTCGSKSIQQCSVRCMNGGTCADDHCQCQKGYIGTYCGQPVC
ENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCC
ATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFE
CRCPAGHKQSETTQKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGYVTSTDGSRCID
QRTGMCFSGLVNGRCAQELPGRMTKMQCCCEPGRCWGIGTIPEACPVRGSEEYRRLCMDG
LPMGGIPGSAGSRPGGTGGNGFAPSGNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGG
QGPIITGLTILNQTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECT
SNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQC
ICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVD
ECQTPGICMNGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFP
GAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICA
NGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPG
YVFRTETETCEDINECESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWL
NIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNECE
VFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKF
RMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAF
PGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFEC
ECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVD
INECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNS
EGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDM
KTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDM
HASCLNIPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGF
TGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNI
CVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPP
DFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCET
CPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQG
YYLSEDTRICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFC
YRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFD
IHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNL
CQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICH
NGFKASQDQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSF
FGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFR
CICPPGYEVKSENCIDINECDEDPNICLFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTR
QSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHG
TVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIG
NPCGNGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAFRCMNTFGSYECTCP
IGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDEN
ECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASS
SRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDGRDIDECKVMPNLC
TNGQCINTMGSFRCFCKVGYTTDISGTSCIDLDECSQSPKPCNYICKNTEGSYQCSCPRG
YVLQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPS
LCGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDECDGNHRCQHGCQNILGGYRCGCP
QGYIQHYQWNQCVDENECSNPNACGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECS
SSKNPCNYGCSNTEGGYLCGCPPGYYRVGQGHCVSGMGFNKGQYLSLDTEVDEENALSPE
ACYECKINGYSKKDSRQKRSIHEPDPTAVEQISLESVDMDSPVNMKFNLSHLGSKEHILE
LRPAIQPLNNHIRYVISQGNDDSVFRIHQRNGLSYLHTAKKKLMPGTYTLEITSIPLYKK
KELKKLEESNEDDYLLGELGEALRMRLQIQLY
NT seq 8739 nt NT seq  +upstreamnt  +downstreamnt
atggggagaagacggaggctgtgtctccagctctacttcctgtggctgggctgtgtggtg
ctctgggcgcagggcacggccggccagcctcagcctcctccgcccaagccgccccggccc
cagccgccgccgcaacaggttcggtccgctacagcaggctctgaaggcgggtttctagcg
cccgagtatcgcgaggagggtgccgcagtggccagccgcgtccgccggcgaggacagcag
gacgtgctccgagggcccaacgtgtgcggctccagattccactcctactgctgccctgga
tggaagacgctccctggaggaaaccagtgcattgtcccgatttgtagaaatagttgtgga
gatggattttgttcccgtcctaacatgtgtacttgttccagtgggcaaatatcatcaacc
tgtggatcaaaatcaattcagcagtgcagtgtgagatgcatgaatggtgggacctgtgca
gatgaccactgccagtgccagaaaggatatattggaacttattgtggacaacctgtctgt
gaaaatggatgtcagaatggtggacgttgcatcggacccaaccgctgtgcttgtgtttat
gggttcactggtccacagtgtgaaagagattacaggacaggcccgtgtttcactcaggtc
aacaaccagatgtgccaagggcagctgacaggcattgtctgcacgaagactctgtgctgt
gccaccattggacgggcgtggggccatccctgtgagatgtgtccagcccagcctcagccc
tgccgacggggtttcatccccaacatccgcactggagcttgccaagatgttgatgaatgc
caggctatcccagggatatgccaaggaggaaactgtatcaatacagtgggctcttttgaa
tgcagatgccctgctggtcacaaacagagtgaaactactcagaaatgtgaagacattgat
gagtgcagcatcattcctgggatatgtgaaactggtgaatgttccaacaccgtgggaagc
tatttttgtgtttgtccacgtggatatgtaacctcaacagatggctctcgatgcatcgat
cagagaacaggcatgtgtttctcgggcctggtgaatggccgctgtgcacaagagctcccg
gggagaatgacgaaaatgcagtgctgctgtgagcctggccgctgctggggcatcggaacc
attcctgaagcctgtcctgtcagaggttctgaggaatatcgcagactttgcatggatgga
cttccaatgggaggaattccagggagtgctggttccagacctggaggcactgggggaaat
ggctttgccccaagtggcaatggcaatggctatggcccaggagggacaggcttcatcccc
atccctggaggcaatggcttttctcctggcgttgggggagccggtgtgggggccggggga
cagggacctatcatcactggactaacaattctgaaccagacaatagatatctgtaagcat
catgctaacctttgtttaaatggacgctgtataccaactgtctcaagctaccgatgtgaa
tgcaacatgggttataagcaggatgcaaatggagattgtatagatgttgatgaatgcaca
tcaaatccctgcactaatggagattgtgttaacacacctggttcctattattgtaaatgt
catgctggattccagaggactcctaccaagcaagcatgcattgatattgatgagtgcatc
cagaatggggttctttgtaaaaacggtcgatgcgtgaacacagatggaagtttccagtgc
atttgcaatgccggctttgaattaactacagatggaaaaaactgtgttgatcatgatgaa
tgtacaactaccaacatgtgtttgaatggaatgtgcatcaatgaagatggcagcttcaag
tgcatctgcaaaccaggatttgtcttggctccaaatgggcgttactgtactgatgttgat
gaatgccagaccccaggaatctgcatgaatgggcactgcatcaacagtgaagggtccttc
cgctgtgactgtcccccaggcctggctgtgggcatggatggacgtgtgtgtgttgatact
cacatgcgcagtacctgctatggaggaatcaagaaaggagtgtgtgtgcgtcctttcccc
ggtgcagtgaccaagtccgaatgctgctgtgccaatccagactatggttttggagaaccc
tgccagccatgccctgcaaaaaattcagctgaattccacggcctttgtagtagtggagta
ggtatcactgtggatggaagagatatcaatgaatgtgctttggatcctgatatatgtgcc
aatgggatttgtgaaaacttacgtggtagttaccgttgtaattgcaacagtggctatgaa
ccagatgcctctggaagaaactgtattgacattgatgaatgtttagtaaacagactgctt
tgtgataacggattgtgccgaaacacgccaggaagttacagctgtacgtgcccaccaggg
tatgtgttcaggactgagacagagacctgtgaagatataaatgaatgtgaaagcaaccca
tgtgtcaatggggcctgcagaaacaaccttggatctttcaattgtgaatgttcgcccggc
agcaaactcagctccacaggattgatctgtattgacagcctgaaggggacctgttggctc
aacatccaggacagccgctgtgaggtgaatattaatggagccactctgaaatctgaatgc
tgtgccaccctcggagccgcctgggggagcccctgtgagcggtgtgaactagatacagct
tgcccaagagggcttgccaggattaaaggtgttacgtgtgaagatgttaatgagtgtgag
gtgttccctggcgtttgtccaaatggacgctgtgtcaacagtaagggatcttttcattgc
gagtgccctgaaggccttacgttggatgggactggccgtgtatgtttggatattcgcatg
gagcagtgttacttgaagtgggatgaagatgaatgcatccaccccgttcctggaaagttc
cgcatggatgcctgctgctgtgctgtcggggcggcttggggcaccgagtgtgaggagtgc
cccaaacctggcaccaaggaatacgagacgctgtgcccccgcggggctggctttgctaac
cgaggggatgttcttactgggcggccattttacaaagacatcaatgaatgcaaagcattt
cctgggatgtgcacttatgggaagtgcagaaatacaatcggaagcttcaaatgccgttgc
aatagtggctttgctctagacatggaggaaagaaactgcacggacatcgacgagtgcagg
atttctcctgacctctgtggcagtggaatctgcgtcaatacaccgggcagctttgagtgc
gagtgcttcgaaggctatgaaagtggcttcatgatgatgaagaactgcatggacattgac
gaatgtgaacgtaaccctctcctttgtaggggtggcacctgtgtgaacactgagggcagc
tttcagtgtgactgcccactgggacacgagctgtcaccatcccgtgaggactgtgtggat
attaatgaatgctccctgagtgacaatctctgcagaaatggaaaatgtgtgaacatgatt
ggaacctatcagtgctcttgcaatcctggatatcaggctacgccagaccgccagggctgt
acagatattgatgaatgtatgataatgaacggaggctgtgacacccagtgcacaaattca
gagggaagctacgaatgcagctgcagtgagggttatgccctgatgccagatgggagatcg
tgtgcagacattgatgaatgtgaaaacaatcctgatatctgtgatggcggccagtgtacc
aacattcctggagagtatcgctgcctctgctatgatggcttcatggcttccatggacatg
aaaacatgcattgatgtcaatgaatgtgacctaaattcaaatatctgcatgtttggggaa
tgtgagaacacaaagggatccttcatttgccactgtcagctgggttactcagtgaagaag
gggaccacaggatgtacagatgtggatgagtgtgaaattggtgctcataactgcgacatg
catgcctcatgtctgaatatcccaggaagcttcaagtgtagctgcagagaaggctggatt
ggaaacggcatcaagtgtattgatctggacgaatgttctaatggaacccaccagtgtagc
atcaatgctcagtgtgtaaataccccgggctcataccgctgtgcctgctccgaaggtttc
actggtgatggctttacctgctcagatgttgatgagtgtgcagaaaacataaacctctgt
gagaacggacagtgccttaatgtcccgggtgcatatcgctgcgagtgtgagatgggcttc
actccagcctcagacagcagatcctgccaagatattgatgaatgctccttccaaaacatt
tgtgtctttggaacatgtaataacctgcctggaatgtttcattgcatctgcgatgatggt
tatgaattggacagaacaggagggaactgtacagatattgatgagtgtgcagatcctata
aactgtgtcaatggcctatgtgtcaacacgcctggtcgctatgagtgtaactgcccaccc
gattttcagttgaacccaactggtgtgggttgtgttgacaaccgtgtgggcaactgctac
ctgaagtttggacctcgaggagatgggagtctgtcttgcaacaccgagatcggggtgggc
gtcagtcgctcttcatgctgctgctctctgggaaaggcctggggaaacccctgtgagaca
tgcccccctgtcaatagcactgaatattacaccctgtgtcccggaggtgaaggcttcaga
cctaaccccatcacaatcattttagaagacattgacgaatgccaggagttaccaggtctc
tgccagggtggaaactgcatcaacacttttgggagcttccagtgtgagtgcccacaaggc
tactacctcagcgaggatacccgcatctgtgaagatattgatgagtgttttgcacatcct
ggtgtgtgtgggcctgggacctgctataacaccctgggaaattacacctgcatttgccca
cctgagtacatgcaggtcaatggaggccacaactgcatggacatgagaaaaagcttttgc
taccgaagctataatggaaccacttgtgagaatgagttgcctttcaatgtgacaaaaagg
atgtgctgctgcacatataatgtgggcaaagcctggaacaaaccttgtgaaccatgccca
actccaggaacagctgactttaaaaccatatgtggaaatattcctggattcacctttgac
attcacacaggaaaagctgttgacattgatgaatgtaaagagattccaggcatttgtgca
aatggtgtgtgcattaaccagattggcagtttccgctgtgaatgccctacaggattcagt
tacaatgacctgctgttggtttgtgaagatatagatgagtgcagcaatggtgataatctc
tgccagcggaatgcagactgcatcaatagtcctggtagttaccgctgtgaatgtgccgcg
ggtttcaaactttcacccaatggggcctgtgtagatcgcaatgaatgtttagaaattcct
aacgtttgcagtcatggcttgtgtgttgatctgcaaggaagttaccagtgcatctgccac
aatggctttaaggcttctcaggaccagaccatgtgcatggatgttgatgagtgcgagcgg
catccatgtggaaatggaacttgtaaaaacaccgttggatcctataactgtctgtgctac
ccagggtttgaactcactcataataatgattgcctggacatagatgagtgcagttccttt
tttggtcaggtgtgcagaaatggacgttgttttaatgaaattggttctttcaagtgtcta
tgtaacgaaggttatgaacttaccccagatggcaaaaactgtatagacactaatgagtgt
gtcgcccttcccggctcttgctctcctggtacctgtcagaatttggagggatccttcaga
tgcatctgtcccccagggtatgaagtaaaaagcgagaactgcattgatataaatgaatgt
gatgaagatcccaacatttgtctttttggttcctgtactaatactccagggggcttccag
tgcctctgcccccctggctttgtactatctgataatggacggagatgctttgatactcgc
cagagcttctgcttcacaaattttgaaaatggaaagtgttctgtacccaaagctttcaac
accacaaaagcaaaatgctgctgtagtaagatgccaggagagggctggggggacccctgt
gagctgtgccccaaagacgatgaagttgcatttcaggatttgtgtccatatggccatgga
actgtccctagtcttcatgatacacgtgaagatgtcaatgagtgtcttgagagcccaggc
atttgttcaaatggtcaatgtatcaacaccgacggatcttttcgctgtgaatgtccaatg
ggctacaaccttgactacactggagtacgctgtgtggatactgatgagtgttcaatcggc
aatccgtgtggaaatggtacatgcaccaatgttattgggagttttgaatgcaattgcaat
gaaggctttgagccagggcccatgatgaattgtgaagatatcaacgaatgtgcccagaac
ccactgctgtgtgctttccgctgcatgaacacttttgggtcctatgaatgcacgtgcccg
attggctatgccctcagggaagatcaaaagatgtgcaaagatctggatgaatgtgctgaa
gggttacacgactgtgaatctaggggcatgatgtgtaagaatctaatcggcaccttcatg
tgcatctgccctcctggaatggcccgaaggcccgatggagaaggctgtgtagatgaaaat
gaatgcaggaccaagccaggaatctgtgaaaatggacgttgtgttaacattattggaagc
tatagatgtgagtgtaatgaaggattccagtcaagttcttcaggcactgaatgccttgac
aatcgacagggtctctgctttgcagaggtactgcagacaatatgtcaaatggcatccagt
agtcgcaatctcgtcactaagtcagaatgctgctgtgatggtgggcgaggctggggccac
cagtgcgagctttgcccacttcctggaactgcccagtacaaaaagatatgtcctcatggc
ccaggatatacaactgatggaagagatattgatgaatgtaaggtaatgccaaacctctgc
accaatggtcagtgcatcaataccatgggctcattccgatgcttctgcaaggttggctac
accacagacatcagtggaacctcttgtatagaccttgatgaatgctcccagtccccgaaa
ccatgcaactacatctgcaagaacactgaggggagttatcagtgttcatgtccgaggggg
tatgtcctgcaagaggatggaaagacatgcaaagaccttgatgaatgtcaaacaaagcag
cataactgccagttcctctgtgtcaacaccctgggggggtttacctgtaaatgtccacct
ggtttcacacagcatcacactgcttgtatcgacaacaacgaatgtgggtctcaaccttcg
ctttgtggagcaaagggaatctgtcaaaacactccaggcagtttcagctgtgaatgccaa
agagggttctctcttgatgccaccggactgaactgtgaagatgttgatgaatgtgatggg
aaccacaggtgccaacacggctgccagaacatcctgggtggctacagatgtggctgcccc
caaggctacatccagcactaccagtggaatcagtgtgtcgatgagaatgaatgctccaat
cccaatgcctgtggctctgcttcctgctacaacaccctggggagttacaagtgcgcctgc
ccctcggggttctccttcgaccagttctccagtgcctgccacgacgtgaatgagtgctcg
tcctccaagaacccctgcaattacggctgctctaacacggaggggggctacctctgtggc
tgcccccctgggtattacagagtgggacaaggccactgtgtctcaggaatgggatttaac
aaggggcagtacctgtcactggatacagaggtcgatgaggaaaatgctctgtccccagaa
gcatgctacgagtgcaaaatcaacggctattctaagaaagacagcaggcagaagagaagt
attcatgaacctgatcccactgctgttgaacagatcagcctagagagtgtcgacatggac
agccccgtcaacatgaagttcaacctctcccacctcggctctaaggagcacatcctggaa
ctaaggcccgccatccagcccctcaacaaccacatccgttatgtcatctctcaagggaac
gatgacagcgtcttccgcatccaccaaaggaatgggctcagctacttgcacacggccaag
aagaagctcatgcccggcacatacacactggaaatcactagcatccctctctacaagaag
aaggagcttaagaaactggaagagagcaatgaggatgactacctcctaggggagcttggg
gaggctctcagaatgaggctgcagattcagctctattaa

DBGET integrated database retrieval system