KEGG   Homo sapiens (human): 220108
Entry
220108            CDS       T01001                                 
Symbol
FAM124A
Name
(RefSeq) family with sequence similarity 124 member A
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: FAM124
Other DBs
NCBI-GeneID: 220108
NCBI-ProteinID: NP_001229241
HGNC: 26413
Ensembl: ENSG00000150510
Pharos: Q86V42(Tdark)
UniProt: Q86V42
Position
13:51222398..51284239
AA seq 546 aa
MDPKAGGGGEEDDCVDSGAETGGSDYSHLSSTSSELSVEEAQDPFLVSIHIIADPGESQP
LQEAIDNVLAWIHPDLPLFRVSERRASRRRRKPPKGAQPALAVVLFLQEEYGEEQILQLH
RTLQQPPWRHHHTEQVHGRFLPYLPCSQDFFTLAPGTPLWAIRPVHYGKEIVRFTVYCRY
DNYADSLRFYQLILRRSPSQKKADFCIFPIFSNLDVDIQFSLKRLPCDQCPVPTDSSVLE
FRVRDIGELVPLLPNPCSPISEGRWQTEDHDGNKILLQAQRVHKKFPKPGRVHHASEKKR
HSTPLPSTAVPSHTPGSSQQSPLNSPHPGPIRTGLPPGHQQEFAGRANSTPNPPWSFQRS
KSLFCLPTGGPSLASSAEPQWFSNTGAPGHRASEWRHGHLLSIDDLEGAQETDVDTGLRL
SSSDLSVVSAYSAPSRFCSTVETPLPSERCSSHWAAHKDSREGPLPTVSRVTTEASWASL
PFFTKRSSSSSATARAAPPAPSTSTLTDSSPQLPCDTPKVKQTDGDMPPPPGSAGPGDND
MEEFYI
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggacccaaaggcgggcggcggcggcgaggaggacgactgcgtggactcgggcgccgag
accggagggtccgactacagccacctgtcctccacgagcagtgagctttccgttgaagag
gcgcaggaccctttcctggtcagcatccacataatcgcagacccaggggagtcccagccc
ctgcaggaggccatcgacaacgtcctggcgtggatccaccccgacctcccgctgttccgg
gtgtccgagaggcgggcgtcccggcggcggcggaagccccccaagggcgctcagccagcg
ctggctgtggtgctgttcctgcaggaggagtacggcgaagagcagatcctgcagctgcac
cgcacactgcagcagccgccctggcgccaccaccacaccgagcaggtgcacggccggttc
ctgccctacctgccctgcagccaggacttcttcacgctggcccctgggacgccgctttgg
gccatccggcccgtgcactacggcaaggaaatcgtgcgcttcaccgtctactgtcgctac
gacaactatgctgacagcctcaggttctaccagctgattctccggaggagccccagccag
aagaaagcggacttctgcatcttccctattttttccaacctggatgtggacatccagttc
tccctgaaaagactgccctgtgaccagtgcccggtgcccaccgactcctccgtgctggag
ttccgagtgagggacataggcgagctcgtgcctctcctgcccaacccttgcagccccatc
agcgaggggcgctggcagacggaggaccatgatgggaacaagatcctcctacaggcacaa
agggtgcataagaagtttcctaaacctggcagagtacatcatgcctccgagaagaaacgt
cattccactcctttgccgagcactgctgtaccaagccatacacctggcagcagccagcag
tccccgctcaacagtcctcacccggggcccatccggacaggcctgcctcctgggcaccag
caggaatttgccggacgagccaacagcacccccaaccctccctggtctttccagagaagc
aagtccttgttttgtttgcccacgggaggcccctccctggcctcctcagctgaaccacag
tggttttcaaacacaggtgccccagggcacagggcatcagagtggaggcatggccacctc
ctctccatcgatgacctagagggggcccaggagacagacgtggacacaggcctgcggctg
tcctcatcggacctgtctgtggtctctgcatattctgcacccagtaggttctgcagcaca
gtggagacacccctcccctccgaaagatgcagcagccactgggcagctcacaaggattcc
agggagggaccactgcccactgtcagcagggtgaccacagaggcctcctgggcttccctc
cctttcttcaccaaaaggtcttccagctcctcagcgacagctcgtgctgctcccccagct
cccagcacctccaccctcacagactcctccccacagctcccatgcgatacccccaaagtc
aagcagactgatggagacatgccaccacccccagggtcggctggccccggggataacgac
atggaggaattctacatctga

DBGET integrated database retrieval system