KEGG   Homo sapiens (human): 220134
Entry
220134            CDS       T01001                                 
Symbol
SKA1, C18orf24
Name
(RefSeq) spindle and kinetochore associated complex subunit 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: SKA1 Sec34 DUF5600 ADIP TniB DUF3161 DUF2465
Other DBs
NCBI-GeneID: 220134
NCBI-ProteinID: NP_001034624
OMIM: 616673
HGNC: 28109
Ensembl: ENSG00000154839
Pharos: Q96BD8(Tbio)
UniProt: Q96BD8 A0A024R294
Structure
Position
18:50375046..50394168
AA seq 255 aa
MASSDLEQLCSHVNEKIGNIKKTLSLRNCGQEPTLKTVLNKIGDEIIVINELLNKLELEI
QYQEQTNNSLKELCESLEEDYKDIEHLKENVPSHLPQVTVTQSCVKGSDLDPEEPIKVEE
PEPVKKPPKEQRSIKEMPFITCDEFNGVPSYMKSRLTYNQINDVIKEINKAVISKYKILH
QPKKSMNSVTRNLYHRFIDEETKDTKGRYFIVEADIKEFTTLKADKKFHVLLNILRHCRR
LSEVRGGGLTRYVIT
NT seq 768 nt   +upstreamnt  +downstreamnt
atggcctcgtcagatctggaacaattatgctctcatgttaatgaaaagattggcaatatt
aagaaaaccttatcattaagaaactgtggccaggaacctaccttgaaaactgtattaaat
aaaataggagatgagatcattgtaataaatgaacttctaaataaattggaattggaaatt
cagtatcaagaacaaaccaacaattcactcaaggaactctgtgaatctcttgaagaagat
tacaaagacatagaacatcttaaagaaaacgttccttcccatttgcctcaagtaacagta
acccagagctgtgttaagggatcagatcttgatcctgaagaaccaatcaaagttgaagaa
cctgaacccgtaaagaagcctcccaaagagcaaagaagtattaaggaaatgccatttata
acttgtgatgagttcaatggtgttccttcgtacatgaaatcccgcttaacctataatcaa
attaatgatgttattaaagaaatcaacaaggcagtaattagtaaatataaaatcctacat
cagccaaaaaagtctatgaattctgtgaccagaaatctctatcacagatttattgatgaa
gaaacgaaggataccaaaggtcgttattttatagtggaagctgacataaaggagttcaca
actttgaaagctgacaagaagtttcacgtgttactgaatattttacgacactgccggagg
ctatcagaggtccgagggggaggacttactcgttatgttataacctga

DBGET integrated database retrieval system