KEGG   Homo sapiens (human): 220136
Entry
220136            CDS       T01001                                 
Symbol
CFAP53, CCDC11, HTX6
Name
(RefSeq) cilia and flagella associated protein 53
  KO
K24225  cilia- and flagella-associated protein 53
Organism
hsa  Homo sapiens (human)
Disease
H00632  Heterotaxy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    220136 (CFAP53)
Cilium and associated proteins [BR:hsa03037]
 Motile cilia and associated proteins
  Other motile cilia associated proteins
   220136 (CFAP53)
SSDB
Motif
Pfam: TPH
Other DBs
NCBI-GeneID: 220136
NCBI-ProteinID: NP_659457
OMIM: 614759
HGNC: 26530
Ensembl: ENSG00000172361
Pharos: Q96M91(Tdark)
UniProt: Q96M91
Position
18:complement(50227193..50266495)
AA seq 514 aa
MYSQRFGTVQREVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAILASIKSSERD
RLKAEWDQHNDCKILDSLVRARIKDAVQGFIINIEERRNKLRELLALEENEYFTEMQLKK
ETIEEKKDRMREKTKLLKEKNEKERQDFVAEKLDQQFRERCEELRVELLSIHQKKVCEER
KAQIAFNEELSRQKLVEEQMFSKLWEEDRLAKEKREAQEARRQKELMENTRLGLNAQITS
IKAQRQATQLLKEEEARLVESNNAQIKHENEQDMLKKQKAKQETRTILQKALQERIEHIQ
QEYRDEQDLNMKLVQRALQDLQEEADKKKQKREDMIREQKIYHKYLAQRREEEKAQEKEF
DRILEEDKAKKLAEKDKELRLEKEARRQLVDEVMCTRKLQVQEKLQREAKEQEERAMEQK
HINESLKELNCEEKENFARRQRLAQEYRKQLQMQIAYQQQSQEAEKEEKRREFEAGVAAN
KMCLDKVQEVLSTHQVLPQNIHPMRKACPSKLPP
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgtacagccagcggtttggcaccgtacagcgggaggttaagggccccacccccaaagtg
gtgatcgtgagatccaagcctcctaaaggccaaggagctgagcaccatctagaaagaatc
cgacgcagccatcagaagcataatgctattttggcttccattaagtcaagtgagcgggat
cgcttgaaagctgagtgggaccagcacaatgactgcaagattttggacagccttgtgcga
gcaagaatcaaggatgctgtgcaagggtttatcattaacattgaagaaagacgaaataag
ctacgtgagcttttagcattagaagaaaatgagtattttacagaaatgcaattgaagaaa
gaaaccattgaggagaaaaaagataggatgagagagaaaactaaattactaaaagagaag
aatgaaaaagagaggcaggattttgtggctgaaaagctagaccagcaattcagggaacgc
tgtgaggagctccgtgttgaattgttatctatccatcagaagaaggtgtgtgaggagcgg
aaagcacagattgcatttaatgaggagctgagcaggcaaaagctggtggaagagcagatg
ttctccaaactctgggaggaagaccgattagccaaggaaaagcgagaagcccaagaggcg
aggagacagaaagagctgatggagaacacacgcctggggctgaatgcccagatcaccagc
atcaaggcacaaaggcaggcgacacagctgctgaaggaagaggaggcacgccttgtggaa
agtaacaacgcacagattaaacatgagaatgaacaggatatgctaaagaaacagaaggca
aagcaggaaactaggaccattttgcaaaaagccctacaagagaggatagaacatattcag
caggaatacagagacgaacaggacttgaacatgaagctcgtgcaaagggcccttcaagac
ttacaggaagaggcagataaaaagaaacaaaaaagagaagatatgataagagaacagaag
atataccataaatatttggcacagagacgtgaggaagaaaaagctcaggagaaagaattt
gacagaatattagaggaagacaaggcaaagaagttggctgagaaggacaaggagctgaga
cttgaaaaggaggcaaggagacagcttgtggatgaggtcatgtgtacaagaaaacttcaa
gttcaagaaaagttgcaacgagaagctaaagaacaggaagaacgtgctatggaacagaaa
cacataaatgaaagtcttaaagaacttaactgtgaagagaaggagaattttgcaagacgc
caacgtttagcccaggagtacaggaagcaacttcagatgcaaatcgcctaccagcagcag
tcccaagaagcagagaaggaagagaaacgccgagagtttgaagcaggtgtagcagcaaac
aagatgtgtttggacaaggtccaggaggtcctgtccacccatcaagtgctgcctcaaaac
attcatcccatgcgcaaggcatgccccagtaagcttccaccgtag

DBGET integrated database retrieval system