KEGG   Homo sapiens (human): 220213
Entry
220213            CDS       T01001                                 
Symbol
OTUD1, DUBA7, OTDC1
Name
(RefSeq) OTU deubiquitinase 1
  KO
K13716  OTU domain-containing protein 1 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    220213 (OTUD1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     220213 (OTUD1)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C85
   220213 (OTUD1)
SSDB
Motif
Pfam: OTU
Other DBs
NCBI-GeneID: 220213
NCBI-ProteinID: NP_001138845
OMIM: 612022
HGNC: 27346
Ensembl: ENSG00000165312
Pharos: Q5VV17(Tdark)
UniProt: Q5VV17
Structure
Position
10:23439075..23442377
AA seq 481 aa
MQLYSSVCTHYPAGAPGPTAAAPAPPAAATPFKVSLQPPGAAGAAPEPETGECQPAAAAE
HREAAAVPAAKMPAFSSCFEVVSGAAAPASAAAGPPGASCKPPLPPHYTSTAQITVRALG
ADRLLLHGPDPVPGAAGSAAAPRGRCLLLAPAPAAPVPPRRGSSAWLLEELLRPDCPEPA
GLDATREGPDRNFRLSEHRQALAAAKHRGPAATPGSPDPGPGPWGEEHLAERGPRGWERG
GDRCDAPGGDAARRPDPEAEAPPAGSIEAAPSSAAEPVIVSRSDPRDEKLALYLAEVEKQ
DKYLRQRNKYRFHIIPDGNCLYRAVSKTVYGDQSLHRELREQTVHYIADHLDHFSPLIEG
DVGEFIIAAAQDGAWAGYPELLAMGQMLNVNIHLTTGGRLESPTVSTMIHYLGPEDSLRP
SIWLSWLSNGHYDAVFDHSYPNPEYDNWCKQTQVQRKRDEELAKSMAISLSKMYIEQNAC
S
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgcagctctacagcagcgtctgcacccactaccccgccggggccccgggtcccacggcc
gccgcccccgcgccacccgccgccgctacccccttcaaggtctcgctgcagcccccggga
gccgccggcgccgcgcccgagcccgagaccggtgagtgccagcccgccgcggccgccgag
caccgggaagccgccgctgtccccgccgccaagatgcccgccttctcctcctgcttcgag
gtggtgtccggggccgccgcgcccgcctccgccgccgccggcccgcccggcgcgtcctgc
aagccgccgctgccgccgcactacacgtccaccgcacagatcaccgtgcgggccctgggc
gccgacaggctcctgctgcacgggcccgatcccgttcccggcgccgcgggctccgccgct
gccccgcgcggccgctgcctcctgctcgccccggcgcccgcagccccggtcccgccgcgg
cggggctcctcggcctggctcctggaggagctgctgcggcccgactgccccgagcccgcg
ggcttggacgcgacacgggaggggcccgatcggaacttccgactgagcgagcaccgccag
gccctggccgccgccaagcaccgaggccccgcggcgaccccggggagccccgatcccggc
cccggtccgtggggcgaagagcacttggcggagaggggccccaggggctgggagaggggc
ggcgatcgctgcgacgcgcccggtggggacgcggcgcggaggcccgacccagaggccgag
gcaccccccgccgggagcatcgaggccgccccgagtagtgcggcggagccggtgatcgtc
tccaggtcggatcccagagacgagaagctggccctatacctggccgaggtggagaagcag
gacaagtatctgcggcagaggaataagtaccgattccacatcattccagacggcaactgc
ctctaccgagctgtcagcaagacggtgtatggggaccagagcctgcaccgggagttgagg
gagcagacggtgcactacatcgccgaccatctcgaccacttcagccccctgattgagggc
gacgtgggggagtttatcatcgctgctgcccaagacggggcatgggccgggtacccggag
ttgctggccatggggcagatgctgaatgtgaatatccatttaactactggagggaggctg
gagagtcccacggtgtctaccatgattcattatttgggcccagaggattccctgaggcct
agtatttggctcagttggctcagtaacggacactatgatgctgtatttgatcactcctat
cctaacccagagtacgacaactggtgcaaacaaactcaagtgcaaaggaaacgcgacgaa
gaacttgccaaatctatggccatatccttgtctaaaatgtatattgaacaaaatgcatgc
tcttga

DBGET integrated database retrieval system