KEGG   Homo sapiens (human): 220323
Entry
220323            CDS       T01001                                 
Symbol
OAF, NS5ATP13TP2
Name
(RefSeq) out at first homolog
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: OAF
Other DBs
NCBI-GeneID: 220323
NCBI-ProteinID: NP_848602
HGNC: 28752
Ensembl: ENSG00000184232
Pharos: Q86UD1(Tbio)
UniProt: Q86UD1
Position
11:120211032..120230334
AA seq 273 aa
MRLPGVPLARPALLLLLPLLAPLLGTGAPAELRVRVRLPDGQVTEESLQADSDADSISLE
LRKPDGTLVSFTADFKKDVKVFRALILGELEKGQSQFQALCFVTQLQHNEIIPSEAMAKL
RQKNPRAVRQAEEVRGLEHLHMDVAVNFSQGALLSPHLHNVCAEAVDAIYTRQEDVRFWL
EQGVDSSVFEALPKASEQAELPRCRQVGDHGKPCVCRYGLSLAWYPCMLKYCHSRDRPTP
YKCGIRSCQKSYSFDFYVPQRQLCLWDEDPYPG
NT seq 822 nt   +upstreamnt  +downstreamnt
atgcgccttcccggggtacccctggcgcgccctgcgctgctgctgctgctgccgctgctc
gcgccgctgctgggaacgggtgcgccggccgagctgcgggtccgcgtgcggctgccggac
ggccaggtgaccgaggagagcctgcaggcggacagcgacgcggacagcatcagcctcgag
ctgcgcaagcccgacggcaccctcgtctccttcaccgccgacttcaagaaggatgtgaag
gtcttccgggccctgatcctgggggagctggagaaggggcagagtcagttccaggccctc
tgctttgtcacccagctgcagcacaatgagatcatccccagtgaggccatggccaagctc
cggcagaaaaatccccgggcagtgcggcaggcggaggaggttcggggtctggagcatctg
cacatggatgtcgctgtcaacttcagccagggggccctgctgagcccccatctccacaac
gtgtgtgccgaggccgtggatgccatctacacccgccaggaggatgtccggttctggctg
gagcaaggtgtggacagttctgtgttcgaggctctgcccaaggcctcagagcaggcggag
ctgcctcgctgcaggcaggtgggggaccacgggaagccctgcgtctgccgctatggcctg
agcctggcctggtacccctgcatgctcaagtactgccacagccgcgaccggcccacgccc
tacaagtgtggcatccgcagctgccagaagagctacagcttcgacttctacgtgccccag
aggcagctgtgtctctgggatgaggatccctacccaggctag

DBGET integrated database retrieval system