KEGG   Homo sapiens (human): 2204Help
Entry
2204              CDS       T01001                                 

Gene name
FCAR, CD89, CTB-61M7.2, FcalphaRI
Definition
(RefSeq) Fc fragment of IgA receptor
  KO
K06513  CD89 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    2204 (FCAR)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    2204 (FCAR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2204 (FCAR)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2204 (FCAR)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    2204 (FCAR)
CD molecules [BR:hsa04090]
 Proteins
  2204 (FCAR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 ig Ig_3 Adeno_E1B_19K
Motif
Other DBs
NCBI-GeneID: 2204
NCBI-ProteinID: NP_001991
OMIM: 147045
HGNC: 3608
Ensembl: ENSG00000186431
Vega: OTTHUMG00000065936
Pharos: P24071(Tbio)
UniProt: P24071
Structure
PDB: 

Position
19q13.42
AA seq 287 aa AA seqDB search
MDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQL
MIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVT
GLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSL
GPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQNLIRMAVAGLVLVA
LLAILVENWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggaccccaaacagaccaccctcctgtgtcttgtgctctgtctgggccagaggattcag
gcacaggaaggggactttcccatgcctttcatatctgccaaatcgagtcctgtgattccc
ttggatggatctgtgaaaatccagtgccaggccattcgtgaagcttacctgacccagctg
atgatcataaaaaactccacgtaccgagagataggcagaagactgaagttttggaatgag
actgatcctgagttcgtcattgaccacatggacgcaaacaaggcagggcgctatcagtgc
caatataggatagggcactacaggttccggtacagtgacaccctggagctggtagtgaca
ggcttgtatggcaaacccttcctctctgcagatcggggtctggtgttgatgccaggagag
aatatttccctcacgtgcagctcagcacacatcccatttgatagattttcactggccaag
gagggagaactttctctgccacagcaccaaagtggggaacacccggccaacttctctttg
ggtcctgtggacctcaatgtctcagggatctacaggtgctacggttggtacaacaggagc
ccctacctgtggtccttccccagtaatgccttggagcttgtggtcacagactccatccac
caagattacacgacgcagaacttgatccgcatggccgtggcaggactggtcctcgtggct
ctcttggccatactggttgaaaattggcacagccatacggcactgaacaaggaagcctcg
gcagatgtggctgaaccgagctggagccaacagatgtgtcagccaggattgacctttgca
cgaacaccaagtgtctgcaagtaa

DBGET integrated database retrieval system