KEGG   Homo sapiens (human): 220441Help
Entry
220441            CDS       T01001                                 

Gene name
RNF152
Definition
(RefSeq) ring finger protein 152
  KO
K15705  E3 ubiquitin-protein ligase RNF152 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    220441 (RNF152)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    220441 (RNF152)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     220441 (RNF152)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    220441 (RNF152)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RING_5 zf-C3HC4 zf-RING_2 zf-RING_UBOX zf-RING_11 zf-C3HC4_2 zf-C3HC4_4 Prok-RING_4 VMA21 zf-RING_10
Motif
Other DBs
NCBI-GeneID: 220441
NCBI-ProteinID: NP_775828
OMIM: 616512
HGNC: 26811
Ensembl: ENSG00000176641
Vega: OTTHUMG00000132774
Pharos: Q8N8N0(Tbio)
UniProt: Q8N8N0
Position
18q21.33
AA seq 203 aa AA seqDB search
METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGVTKL
PPGFSVSQLPDDPEVLAVIAIPHTSEHTPVFIKLPSNGCYMLPLPISKERALLPGDMGCR
LLPGSQQKSVTVVTIPAEQQPLQGGAPQEAVEEEQDRRGVVKSSTWSGVCTVILVACVLV
FLLGIVLHNMSCISKRFTVISCG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggagacgctgtcccaggactctctgctggaatgtcagatctgtttcaattactacagc
ccccggcgcaggcccaagttgctggactgcaagcacacctgctgttcagtgtgcctgcag
cagatgaggaccagccagaaggatgtgcggtgcccctggtgccgcggtgtcaccaagctg
cctcccggcttctccgtgtcgcagctcccggacgacccggaggtcctggctgtcatcgcc
attccacacacttccgaacacaccccggtcttcatcaaacttcccagcaatgggtgctac
atgctgcccctgcccatctccaaggagcgtgcgctgctgcccggagacatgggctgccgc
ctgctgcccgggagccagcagaagtccgtcaccgtggtgaccatccctgctgaacagcag
cctctgcaaggtggggctccccaggaggcggtggaggaggagcaggacaggcggggcgtg
gtgaaaagctccacctggtcgggggtgtgcactgtcatcttggtggcttgcgtcttggtc
ttcctcctcggcatcgtgcttcacaacatgtcttgcatttctaagcgcttcactgtgata
tcctgtggctga

DBGET integrated database retrieval system