KEGG   Homo sapiens (human): 2206Help
Entry
2206              CDS       T01001                                 

Gene name
MS4A2, APY, ATOPY, FCER1B, FCERI, IGEL, IGER, IGHER, MS4A1
Definition
(RefSeq) membrane spanning 4-domains A2
  KO
K08090  high affinity immunoglobulin epsilon receptor subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa05310  Asthma
Disease
H00079  Asthma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    2206 (MS4A2)
   04071 Sphingolipid signaling pathway
    2206 (MS4A2)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    2206 (MS4A2)
 09160 Human Diseases
  09163 Immune diseases
   05310 Asthma
    2206 (MS4A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2206 (MS4A2)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   2206 (MS4A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD20
Motif
Other DBs
NCBI-GeneID: 2206
NCBI-ProteinID: NP_000130
OMIM: 147138
HGNC: 7316
Ensembl: ENSG00000149534
Vega: OTTHUMG00000167239
Pharos: Q01362(Tbio)
UniProt: Q01362
Position
11q12.1
AA seq 244 aa AA seqDB search
MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEF
LGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISER
RNATYLVRGSLGANTASSIAGGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTE
IVVMMLFLTILGLGSAVSLTICGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSP
PIDL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggacacagaaagtaataggagagcaaatcttgctctcccacaggagccttccagtgtg
cctgcatttgaagtcttggaaatatctccccaggaagtatcttcaggcagactattgaag
tcggcctcatccccaccactgcatacatggctgacagttttgaaaaaagagcaggagttc
ctgggggtaacacaaattctgactgctatgatatgcctttgttttggaacagttgtctgc
tctgtacttgatatttcacacattgagggagacattttttcatcatttaaagcaggttat
ccattctggggagccatatttttttctatttctggaatgttgtcaattatatctgaaagg
agaaatgcaacatatctggtgagaggaagcctgggagcaaacactgccagcagcatagct
gggggaacgggaattaccatcctgatcatcaacctgaagaagagcttggcctatatccac
atccacagttgccagaaattttttgagaccaagtgctttatggcttccttttccactgaa
attgtagtgatgatgctgtttctcaccattctgggacttggtagtgctgtgtcactcaca
atctgtggagctggggaagaactcaaaggaaacaaggttccagaggatcgtgtttatgaa
gaattaaacatatattcagctacttacagtgagttggaagacccaggggaaatgtctcct
cccattgatttataa

DBGET integrated database retrieval system