KEGG   Homo sapiens (human): 2207Help
Entry
2207              CDS       T01001                                 

Gene name
FCER1G, FCRG
Definition
(RefSeq) Fc fragment of IgE receptor Ig
  KO
K07983  high affinity immunoglobulin epsilon receptor subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04611  Platelet activation
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04664  Fc epsilon RI signaling pathway
hsa05152  Tuberculosis
hsa05310  Asthma
Drug target
Benzylpenicilloyl polylysine: D03095
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    2207 (FCER1G)
   04071 Sphingolipid signaling pathway
    2207 (FCER1G)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    2207 (FCER1G)
   04625 C-type lectin receptor signaling pathway
    2207 (FCER1G)
   04650 Natural killer cell mediated cytotoxicity
    2207 (FCER1G)
   04664 Fc epsilon RI signaling pathway
    2207 (FCER1G)
 09160 Human Diseases
  09163 Immune diseases
   05310 Asthma
    2207 (FCER1G)
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    2207 (FCER1G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2207 (FCER1G)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   2207 (FCER1G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TCR_zetazeta ITAM SGS
Motif
Other DBs
NCBI-GeneID: 2207
NCBI-ProteinID: NP_004097
OMIM: 147139
HGNC: 3611
Ensembl: ENSG00000158869
Vega: OTTHUMG00000034343
Pharos: P30273(Tbio)
UniProt: P30273
Position
1q23.3
AA seq 86 aa AA seqDB search
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEK
SDGVYTGLSTRNQETYETLKHEKPPQ
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgattccagcagtggtcttgctcttactccttttggttgaacaagcagcggccctggga
gagcctcagctctgctatatcctggatgccatcctgtttctgtatggaattgtcctcacc
ctcctctactgtcgactgaagatccaagtgcgaaaggcagctataaccagctatgagaaa
tcagatggtgtttacacgggcctgagcaccaggaaccaggagacttacgagactctgaag
catgagaaaccaccacagtag

DBGET integrated database retrieval system