KEGG   Homo sapiens (human): 220963Help
Entry
220963            CDS       T01001                                 

Gene name
SLC16A9, C10orf36, MCT9
Definition
(RefSeq) solute carrier family 16 member 9
  KO
K08186  MFS transporter, MCP family, solute carrier family 16 (monocarboxylic acid transporters), member 9
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    220963 (SLC16A9)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC16: Monocarboxylate transporter
   220963 (SLC16A9)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Monocarboxylate porter (MCP) family [TC:2.A.1.13]
    220963 (SLC16A9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 220963
NCBI-ProteinID: NP_001310910
OMIM: 614242
HGNC: 23520
Ensembl: ENSG00000165449
Vega: OTTHUMG00000018283
Pharos: Q7RTY1(Tdark)
UniProt: Q7RTY1
Position
10q21.2
AA seq 509 aa AA seqDB search
MELKKSPDGGWGWVIVFVSFLTQFLCYGSPLAVGVLYIEWLDAFGEGKGKTAWVGSLASG
VGLLASPVCSLCVSSFGARPVTIFSGFMVAGGLMLSSFAPNIYFLFFSYGIVVGLGCGLL
YTATVTITCQYFDDRRGLALGLISTGSSVGLFIYAALQRMLVEFYGLDGCLLIVGALALN
ILACGSLMRPLQSSDCPLPKKIAPEDLPDKYSIYNEKGKNLEENINILDKSYSSEEKCRI
TLANGDWKQDSLLHKNPTVTHTKEPETYKKKVAEQTYFCKQLAKRKWQLYKNYCGETVAL
FKNKVFSALFIAILLFDIGGFPPSLLMEDVARSSNVKEEEFIMPLISIIGIMTAVGKLLL
GILADFKWINTLYLYVATLIIMGLALCAIPFAKSYVTLALLSGILGFLTGNWSIFPYVTT
KTVGIEKLAHAYGILMFFAGLGNSLGPPIVGWFYDWTQTYDIAFYFSGFCVLLGGFILLL
AALPSWDTCNKQLPKPAPTTFLYKVASNV
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggaacttaaaaagtcgcctgacggtggatggggctgggtgattgtgtttgtctccttc
cttactcagtttttgtgttacggatccccactagctgttggagtcctgtacatagaatgg
ctggatgcctttggtgaaggaaaaggaaaaacagcctgggttggatccctggcaagtgga
gttggcttgcttgcaagtcctgtctgcagtctctgtgtctcatcttttggagcaagacct
gtcacaatcttcagtggcttcatggtggctggaggcctgatgttgagcagttttgctccc
aatatctactttctgtttttttcctatggcattgttgtaggtcttggatgtggtttatta
tacactgcaacagtgaccattacgtgccagtattttgacgatcgccgaggcctagcgctt
ggcctgatttcaacaggttcaagcgttggccttttcatatatgctgctctgcagaggatg
ctggttgagttctatggactggatggatgcttgctgattgtgggtgctttagctttaaat
atattagcctgtggcagtctgatgagacccctccaatcttctgattgtcctttgcctaaa
aaaatagctccagaagatctaccagataaatactccatttacaatgaaaaaggaaagaat
ctggaagaaaacataaacattcttgacaagagctacagtagtgaggaaaaatgcaggatc
acgttagccaatggtgactggaaacaagacagcctacttcataaaaaccccacagtgaca
cacacaaaagagcctgaaacgtacaaaaagaaagttgcagaacagacatatttttgcaaa
cagcttgccaagaggaagtggcagttatataaaaactactgtggtgaaactgtggctctt
tttaaaaacaaagtattttcagcccttttcattgctatcttactctttgacatcggaggg
tttccaccttcattacttatggaagatgtagcaagaagttcaaacgtgaaagaagaagag
tttattatgccacttatttccattataggcattatgacagcagttggtaaactgctttta
gggatactggctgacttcaagtggattaataccttgtatctttatgttgctaccttaatc
atcatgggcctagccttgtgtgcaattccatttgccaaaagctatgtcacattggcgttg
ctttctgggatcctagggtttcttactggtaattggtccatctttccatatgtgaccacg
aagactgtgggaattgaaaaattagcccatgcctatgggatattaatgttctttgctgga
cttggaaatagcctaggaccacccatcgttggttggttttatgactggacccagacctat
gatattgcattttattttagtggcttctgcgtcctgctgggaggttttattctgctgctg
gcagccttgccctcttgggatacatgcaacaagcaactccccaagccagctccaacaact
ttcttgtacaaagttgcctctaatgtttag

DBGET integrated database retrieval system