KEGG   Homo sapiens (human): 220965Help
Entry
220965            CDS       T01001                                 

Gene name
FAM13C, FAM13C1
Definition
(RefSeq) family with sequence similarity 13 member C
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 220965
NCBI-ProteinID: NP_937858
HGNC: 19371
Ensembl: ENSG00000148541
Vega: OTTHUMG00000018277
Pharos: Q8NE31(Tdark)
UniProt: Q8NE31 A8K181
Position
10q21.1
AA seq 585 aa AA seqDB search
MFSCFCFSLQDNSFSSTTVTECDEDPVSLHEDQTDCSSLRDENNKENYPDAGALVEEHAP
PSWEPQQQNVEATVLVDSVLRPSMGNFKSRKPKSIFKAESGRSHGESQETEHVVSSQSEC
QVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKDAFETRQDLNEEEAAQVHGVKD
PAPASTQSVLADGTDSADPSPVHKDGQNEADSAPEDLHSVGTSRLLYHITDGDNPLLSPR
CSIFSQSQRFNLDPESAPSPPSTQQFMMPRSSSRCSCGDGKEPQTITQLTKHIQSLKRKI
RKFEEKFEQEKKYRPSHGDKTSNPEVLKWMNDLAKGRKQLKELKLKLSEEQGSAPKGPPR
NLLCEQPTVPRENGKPEAAGPEPSSSGEETPDAALTCLKERREQLPPQEDSKVTKQDKNL
IKPLYDRYRIIKQILSTPSLIPTIQEEEDSDEDRPQGSQQPSLADPASHLPVGDHLTYSN
ETEPVRALLPDEKKEVKPPALSMSNLHEATMPVLLDHLRETRADKKRLRKALREFEEQFF
KQTGRSPQKEDRIPMADEYYEYKHIKAKLRLLEVLISKQDVAKTI
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgttttcttgtttctgtttcagccttcaggataattccttcagcagcaccactgtaaca
gagtgtgacgaagatccagtctctctacatgaagaccagactgattgctccagtctcaga
gatgaaaacaataaagagaactaccccgacgcaggggctctggtagaagagcacgcgccg
ccctcttgggagccgcagcagcagaatgtagaggcgaccgtgctggtggacagcgtattg
cgacccagcatgggcaacttcaagtccaggaagcccaagtccatcttcaaagcggagagc
gggaggagccacggagaaagtcaggagacagagcatgtggtatccagccagtcagagtgt
caggtgagagcaggaacaccagctcatgagagtccacaaaacaatgccttcaagtgccaa
gaaacagtgcgacttcaaccaagaatagaccagaggactgccatttcgccaaaggatgct
tttgaaactcggcaggacttaaatgaggaagaagctgctcaggtgcatggagtcaaggac
ccggcgccagcatcaacccagagcgtgcttgccgatgggacagattctgcagacccctca
ccagtccacaaagatgggcagaatgaggccgacagtgcaccagaagacctccactctgtg
gggaccagcaggctgctctatcacatcactgatggtgataacccactgctgtcgccacga
tgctccatcttcagccaaagccagagattcaacttagaccccgagtcagccccatctcca
cccagcactcagcagtttatgatgccgcggagttcttcacgctgcagctgtggagatggc
aaggagccacagaccatcacccagctcaccaagcacatccagagcctcaagcggaaaatt
cggaaatttgaagaaaaatttgaacaagaaaagaaataccggccttcacatggtgacaag
acttctaatcctgaagtcctgaaatggatgaatgatttggctaaaggtcgtaaacagctc
aaagaactaaagctaaagctgtcagaagaacaagggagtgctcccaaaggtccacctaga
aacctgttgtgtgagcaacccacagtccccagagaaaatgggaaaccggaagctgcgggc
ccggagccaagctcctctggagaagagactccagatgctgccttgacatgcctgaaggag
agaagagagcaacttcctccccaggaggattctaaggtaactaagcaagacaagaacctc
ataaagccgctttatgaccgatacagaattatcaagcaaatcttgtcaacaccttccctt
attccaacaattcaggaggaagaggactctgatgaagaccgtccacagggaagccaacaa
ccttctttggcagatccagcatctcaccttcctgttggtgaccacctcacctactctaat
gagactgagcctgttagggcccttttaccagatgaaaagaaagaagtaaaaccaccagct
ctctccatgtctaatttacatgaggctaccatgcctgtacttcttgaccatctccgagaa
actagggctgacaagaagagactgcggaaagccttaagagaatttgaagaacagtttttt
aaacaaacaggaagaagtccacaaaaggaagataggataccaatggcagatgagtattat
gaatataagcacataaaagccaaactgagactattagaggtcctcatcagcaagcaagat
gtggccaaaactatttga

DBGET integrated database retrieval system