KEGG   Homo sapiens (human): 2210Help
Entry
2210              CDS       T01001                                 

Gene name
FCGR1B, CD64b, FCG1, FCGR1, FCGR1A, FcRI, FcgammaRIa, IGFR1, IGFRB
Definition
(RefSeq) Fc fragment of IgG receptor Ib
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 V-set I-set ig Ig_4 PIRT Adeno_E3_CR1
Motif
Other DBs
NCBI-GeneID: 2210
NCBI-ProteinID: NP_001017986
OMIM: 601502
HGNC: 3614
Ensembl: ENSG00000198019
Vega: OTTHUMG00000040903
Pharos: Q92637(Tdark)
UniProt: Q92637
Position
1p11.2
AA seq 280 aa AA seqDB search
MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNG
TATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFMEGEPL
ALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAG
ISQYTVKGLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTIRKELKRKKKWNLEISLDSGHE
KKVISSLQEDRHLEEELKCQEQKEEQLQEGVHRKEPQGAT
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcttgacaactctgctcctttgggttccagttgatgggcaagtggacaccaca
aaggcagtgatcactttgcagcctccatgggtcagcgtgttccaagaggaaaccgtaacc
ttgcactgtgaggtgctccatctgcctgggagcagctccacacagtggtttctcaatggc
acagccactcagacctcgacccccagctacagaatcacctctgccagtgtcaatgacagt
ggtgaatacaggtgccagagaggtctctcagggcgaagtgaccccatacagctggaaatc
cacagaggctggctactactgcaggtctccagcagagtcttcatggaaggagaacctctg
gccttgaggtgtcatgcgtggaaggataagctggtgtacaatgtgctttactatcgaaat
ggcaaagcctttaagtttttccactggaattctaacctcaccattctgaaaaccaacata
agtcacaatggcacctaccattgctcaggcatgggaaagcatcgctacacatcagcagga
atatcacaatacactgtgaaaggcctccagttaccaactcctgtctggtttcatgtcctt
ttctatctggcagtgggaataatgtttttagtgaacactgttctctgggtgacaatacgt
aaagaactgaaaagaaagaaaaagtggaatttagaaatctctttggattctggtcatgag
aagaaggtaatttccagccttcaagaagacagacatttagaagaagagctgaaatgtcag
gaacaaaaagaagaacagctgcaggaaggggtgcaccggaaggagccccagggggccacg
tag

DBGET integrated database retrieval system