KEGG   Homo sapiens (human): 221035
Entry
221035            CDS       T01001                                 
Symbol
REEP3, C10orf74, Yip2b
Name
(RefSeq) receptor accessory protein 3
  KO
K17338  receptor expression-enhancing protein 1/2/3/4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    221035 (REEP3)
SSDB
Motif
Pfam: TB2_DP1_HVA22
Other DBs
NCBI-GeneID: 221035
NCBI-ProteinID: NP_001001330
OMIM: 609348
HGNC: 23711
Ensembl: ENSG00000165476
Pharos: Q6NUK4(Tbio)
UniProt: Q6NUK4 X5DR89
Position
10:63521401..63625128
AA seq 255 aa
MVSWMISRAVVLVFGMLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTVA
WFPLYYELKIAFVIWLLSPYTKGASLIYRKFLHPLLSSKEREIDDYIVQAKERGYETMVN
FGRQGLNLAATAAVTAAVKSQGAITERLRSFSMHDLTTIQGDEPVGQRPYQPLPEAKKKS
KPAPSESAGYGIPLKDGDEKTDEEAEGPYSDNEMLTHKGLRRSQSMKSVKTTKGRKEVRY
GSLKYKVKKRPQVYF
NT seq 768 nt   +upstreamnt  +downstreamnt
atggtgtcctggatgatctccagagccgtggtgctggtgtttggaatgctttatcctgca
tattattcatacaaagctgtgaaaacaaaaaacgtgaaggaatatgttcgatggatgatg
tactggattgtttttgctctctatactgtgattgaaacagtagccgatcaaacagttgct
tggtttcccctgtactatgagctgaagattgcttttgtcatatggctgctttctccctat
accaaaggagcaagtttaatatatagaaaattccttcatccacttctttcttcaaaggaa
agggagattgatgattatattgtacaagcaaaggaacgaggctatgaaaccatggtaaac
tttggacggcaaggtttaaaccttgcagctactgctgctgttactgcagcagtaaagagc
caaggagcaataactgaacgtttaagaagcttcagtatgcatgatttaacaactatccaa
ggtgatgagcctgtgggacaaagaccataccaacctctaccagaagcaaaaaagaaaagt
aaaccagcccccagtgaatcagcaggttatggaattccactgaaagacggagatgagaaa
acagatgaagaagcagaggggccatattcagataatgagatgttaacacacaaagggctt
cgaagatcgcaaagcatgaaatctgtgaaaaccaccaaaggccgcaaagaggtgcggtac
gggtcactaaaatacaaagtgaagaaacgaccacaagtgtatttttag

DBGET integrated database retrieval system