KEGG   Homo sapiens (human): 221061
Entry
221061            CDS       T01001                                 
Symbol
FAM171A1, APCN, C10orf38
Name
(RefSeq) family with sequence similarity 171 member A1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: UPF0560
Other DBs
NCBI-GeneID: 221061
NCBI-ProteinID: NP_001010924
HGNC: 23522
Ensembl: ENSG00000148468
Pharos: Q5VUB5(Tdark)
UniProt: Q5VUB5 Q9Y438 B3KMX9
Position
10:complement(15211643..15374554)
AA seq 890 aa
MSRSATLLLCLLGCHVWKAVTKTLREPGAGAQEVTLKVHISDASTHQPVADALIEIFTNQ
ASIASGTSGTDGVAFIKFQYKLGSQLIVTASKHAYVPNSAPWKPIRLPVFSSLSLGLLPE
RSATLMVYEDVVQIVSGFQGARPQPRVHFQRRALRLPENTSYSDLTAFLTAASSPSEVDS
FPYLRGLDGNGTGNSTRHDLTPVTAVSVHLLSSNGTPVLVDGPIYVTVPLATQSSLRHNA
YVAAWRFDQKLGTWLKSGLGLVHQEGSQLTWTYIAPQLGYWVAAMSPPIPGPVVTQDITT
YHTVFLLAILGGMAFILLVLLCLLLYYCRRKCLKPRQHHRKLQLPAGLESSKRDQSTSMS
HINLLFSRRASEFPGPLSVTSHGRPEAPGTKELMSGVHLEMMSPGGEGDLHTPMLKLSYS
TSQEFSSREELLSCKEEDKSQISFDNLTPSGTLGKDYHKSVEVFPLKARKSMEREGYESS
GNDDYRGSYNTVLSQPLFEKQDREGPASTGSKLTIQEHLYPAPSSPEKEQLLDRRPTECM
MSRSVDHLERPTSFPRPGQLICCSSVDQVNDSVYRKVLPALVIPAHYMKLPGDHSYVSQP
LVVPADQQLEIERLQAELSNPHAGIFPHPSSQIQPQPLSSQAISQQHLQDAGTREWSPQN
ASMSESLSIPASLNDAALAQMNSEVQLLTEKALMELGGGKPLPHPRAWFVSLDGRSNAHV
RHSYIDLQRAGRNGSNDASLDSGVDMNEPKSARKGRGDALSLQQNYPPVQEHQQKEPRAP
DSTAYTQLVYLDDVEQSGSECGTTVCTPEDSALRCLLEGSSRRSGGQLPSLQEETTRRTA
DAPSEPAASPHQRRSAHEEEEDDDDDDQGEDKKSPWQKREERPLMAFNIK
NT seq 2673 nt   +upstreamnt  +downstreamnt
atgagcaggtccgcgacgctgctgctgtgcctgctgggctgccacgtctggaaggcggtg
accaagacgctgcgggagcccggcgccggagcccaagaggtgacgttaaaggtgcacatc
agcgacgccagcacccaccagcccgtagcagatgcgctcatcgagatcttcaccaaccag
gcctccatagcctctggcacctcggggactgatggcgtcgcctttatcaagttccagtat
aagctgggcagtcagttgattgtcaccgcctcgaagcatgcctacgtgccaaactctgcc
ccatggaagccaatccggttacctgtattttcctctctgagccttggcctgcttccagaa
cgctctgccactctaatggtatatgaagatgtcgtccaaatagtatcaggattccaaggt
gcccggccacagcctcgcgttcatttccagagaagggctctgaggttgcctgagaacacc
agctacagtgacctgaccgcgtttctcacggccgccagctccccttcggaggtggacagt
tttccttatttgcgaggattagacggaaatggaacaggaaacagcaccaggcatgacctg
accccagtcacagccgtcagcgtccacttgctgagcagtaatggaacgccggtgctggtg
gatggtcccatctatgtcactgtgcccctggccacgcagagcagcctgaggcacaatgcc
tatgtcgcggcgtggcggtttgaccagaagctgggaacgtggctgaagagcggtctgggt
cttgtgcaccaggaaggcagccagctgacgtggacatacattgccccccagttggggtac
tgggtggccgccatgtcccctcccatcccaggtcccgttgtaacacaggacattaccacg
tatcacacggtgtttcttttggccattttaggaggaatggctttcatacttttggttttg
ctgtgtctccttttatattattgcaggaggaagtgcttgaaacctcgtcagcaccacaga
aaactgcagctccctgcaggactggagagttccaaaagagaccagtccacgtccatgtca
cacattaacttgctgttttcacgccgagcgtcagaattccctggcccgctgtccgtcacc
agccacggccgccccgaggcccccggcacgaaggaactgatgagtggagtccatttggaa
atgatgtctccgggcggcgaaggggacctgcacacccccatgctcaagctctcctacagc
acctcccaggaatttagctcccgggaggagctcctctcttgcaaggaagaggataaaagc
cagatctcctttgataacctcactccaagtgggacgctggggaaagactaccataagtca
gtggaggtttttcccttaaaggcaagaaaatctatggaaagagaaggctacgagtcctcg
ggcaatgatgactacaggggtagttacaacaccgtgctctcacagcctttatttgaaaag
caggacagagaaggtccagcctccacgggaagcaaactcaccattcaggaacatctgtac
cccgcgccttcatcacctgagaaagaacagctgctggaccgcagacccactgaatgtatg
atgtcgcgatcagtagatcacctcgagagacctacgtccttcccacggcccggccagtta
atctgctgcagttctgtcgaccaggtcaatgacagcgtttacaggaaagtactgcctgcc
ttggtcatcccggctcattatatgaaactccccggggaccactcctatgtcagccagccc
ctcgtcgtcccggctgatcagcagcttgagatagaaagactacaggctgagctgtccaat
ccccatgccgggatcttcccacacccgtcctcacagatccagccccagcccctgtcttcc
caggccatctctcagcagcacctgcaggatgcgggcacccgggagtggagccctcagaac
gcatccatgtcggagtctctctccatcccagcttccctgaacgacgcggctttggctcag
atgaacagtgaggtgcagctcctgactgaaaaggccctgatggagcttgggggtgggaag
ccgcttccgcacccccgggcgtggttcgtctccttggatggcaggtccaacgctcacgtt
agacattcatacattgatctccaaagagctggaaggaacggaagtaatgatgccagtttg
gactctggcgtagatatgaatgaaccaaaatcagcccggaagggaaggggagatgctttg
tctctgcagcagaactacccgcccgtccaagagcaccagcagaaagagcctcgagcccca
gacagcacggcctacacgcagctcgtgtacctggatgacgtggaacagagtggtagcgaa
tgtgggaccacggtctgtacccccgaggacagtgccctgcgatgcttgttggaggggtcg
agtcggagaagtggtggccagctgcccagcctgcaggaggagacgaccagacggactgcg
gatgccccctcggagccagcagccagcccccaccagagaagatctgcccacgaggaagag
gaagacgatgatgatgatgaccaaggagaagacaagaaaagcccctggcagaaacgggag
gagaggcccctgatggcgtttaacattaaatga

DBGET integrated database retrieval system