KEGG   Homo sapiens (human): 221178Help
Entry
221178            CDS       T01001                                 

Gene name
SPATA13, ARHGEF29, ASEF2
Definition
(RefSeq) spermatogenesis associated 13
  KO
K05769  Rho guanine nucleotide exchange factor 4/29
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    221178 (SPATA13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    221178 (SPATA13)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    221178 (SPATA13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF SH3_1 PH SH3_9 SH3_2
Motif
Other DBs
NCBI-GeneID: 221178
NCBI-ProteinID: NP_694568
OMIM: 613324
HGNC: 23222
Ensembl: ENSG00000182957 ENSG00000228741 ENSG00000273167
Vega: OTTHUMG00000016578 OTTHUMG00000186016
Pharos: Q96N96(Tbio)
UniProt: Q96N96 A0A024RDM6
Position
13q12.12
AA seq 652 aa AA seqDB search
MTSASPEDQNAPVGCPKGARRRRPISVIGGVSLYGTNQTEELDNLLTQPASRPPMPAHQV
PPYKAVSARFRPFTFSQSTPIGLDRVGRRRQMRASNVSSDGGTEPSALVDDNGSEEDFSY
EDLCQASPRYLQPGGEQLAINELISDGNVVCAEALWDHVTMDDQELGFKAGDVIQVLEAS
NKDWWWGRSEDKEAWFPASFVRLRVNQEELSENSSSTPSEEQDEEASQSRHRHCENKQQM
RTNVIREIMDTERVYIKHLRDICEGYIRQCRKHTGMFTVAQLATIFGNIEDIYKFQRKFL
KDLEKQYNKEEPHLSEIGSCFLQNQEGFAIYSEYCNNHPGACLELANLMKQGKYRHFFEA
CRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTTQEHGDYSNIKAAYEAMKNVACL
INERKRKLESIDKIARWQVSIVGWEGLDILDRSSELIHSGELTKITKQGKSQQRTFFLFD
HQLVSCKKDLLRRDMLYYKGRLDMDEMELVDLGDGRDKDCNLSVKNAFKLVSRTTDEVYL
FCAKKQEDKARWLQACADERRRVQEDKEMGMEISENQKKLAMLNAQKAGHGKSKGYNRCP
VAPPHQGLHPIHQRHITMPTSVPQQQVFGLAEPKRKSSLFWHTFNRLTPFRK
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgccagccctgaagaccagaatgctccagtgggctgccccaaaggagcccgg
agaaggcgccccatttccgtgataggtggggtcagcttgtatgggaccaaccagacggag
gaactggacaatcttctgacccaaccggcttccaggccgcccatgcctgctcaccaggtg
ccaccctacaaggctgtgtcggcccggttccggcccttcacattctcccagagcaccccc
attgggttggaccgtgtgggacgccggcggcagatgagagcatccaacgtttcttcagat
ggaggtactgagccctctgccttagtggatgacaacggtagtgaggaggacttcagctat
gaagacctctgccaggccagccctcggtacctgcagcccggcggggagcagctggccatc
aatgagctgatcagtgatggcaacgtggtctgcgcagaagccctgtgggaccatgtgacc
atggatgaccaggaactgggcttcaaagccggggatgtcatccaggttctggaagcctcc
aacaaggactggtggtggggccgcagtgaagataaggaagcctggttccccgcgagcttc
gtcagattgcgagtgaatcaggaagagctgtcggaaaactccagcagcacccccagtgag
gagcaggacgaggaggccagccagagccgccacagacactgtgagaacaagcagcagatg
cggaccaacgtcatccgggagatcatggacaccgagcgggtgtacatcaaacacctcagg
gacatctgtgagggctatatccgacagtgccgcaagcacacaggaatgttcaccgttgcg
cagctagccactatttttggaaacattgaagatatttacaaattccaaagaaagtttctg
aaagaccttgagaaacagtacaacaaagaggaacctcacttaagtgaaataggatcttgc
tttcttcaaaatcaagagggctttgccatctattccgagtactgcaacaaccacccgggc
gcctgcctggagctcgccaacctcatgaagcagggcaagtacagacatttctttgaagcc
tgccgcctgctgcagcagatgattgacatcgccatcgacgggttcctgctcacaccagtg
cagaagatctgcaaatacccgctgcagctggccgagctgctcaagtataccacacaggaa
cacggtgattacagcaacataaaggcagcatatgaggccatgaagaatgtggcctgtctg
atcaacgagcgcaagcgcaagctggagagcatcgacaagatagctcgctggcaggtgtct
atcgtgggctgggagggactggatatcttagaccgaagctcagaattgattcattctggg
gagctgaccaaaatcactaagcaaggcaaaagccagcagcggacgttcttcctgtttgac
caccagctggtgtcctgcaagaaggacctgctgcgcagggacatgctgtactacaagggc
cggctggacatggatgagatggagcttgtggacctgggggatgggcgcgacaaggactgc
aacctcagcgtgaaaaatgccttcaagctcgtcagtaggaccacagacgaggtttatttg
ttttgtgccaaaaaacaagaagacaaggcgaggtggctgcaggcctgtgcagatgaaagg
aggcgggtgcaagaggacaaggagatgggaatggaaatttcagaaaaccagaagaaactt
gccatgttaaatgctcaaaaggcaggacatggaaagtcaaaaggctacaacaggtgccct
gtggccccaccgcaccagggcctgcaccccatccaccagcgccacatcactatgcccaca
agcgtcccccagcagcaggtctttggcctggcggaacccaagaggaagtcctcgctcttc
tggcacaccttcaacaggctcacccccttccggaaatga

DBGET integrated database retrieval system