KEGG   Homo sapiens (human): 221184
Entry
221184            CDS       T01001                                 
Symbol
CPNE2, COPN2, CPN2
Name
(RefSeq) copine 2
  KO
K24524  copine 1/2/3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    221184 (CPNE2)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Von Willebrand domain-containing proteins
  VWA domain-containing proteins
   221184 (CPNE2)
SSDB
Motif
Pfam: Copine C2 vWA-TerF-like VMAP-M1
Other DBs
NCBI-GeneID: 221184
NCBI-ProteinID: NP_689940
OMIM: 604206
HGNC: 2315
Ensembl: ENSG00000140848
Pharos: Q96FN4(Tdark)
UniProt: Q96FN4
Position
16:57092583..57148369
AA seq 548 aa
MAHIPSGGAPAAGAAPMGPQYCVCKVELSVSGQNLLDRDVTSKSDPFCVLFTENNGRWIE
YDRTETAINNLNPAFSKKFVLDYHFEEVQKLKFALFDQDKSSMRLDEHDFLGQFSCSLGT
IVSSKKITRPLLLLNDKPAGKGLITIAAQELSDNRVITLSLAGRRLDKKDLFGKSDPFLE
FYKPGDDGKWMLVHRTEVIKYTLDPVWKPFTVPLVSLCDGDMEKPIQVMCYDYDNDGGHD
FIGEFQTSVSQMCEARDSVPLEFECINPKKQRKKKNYKNSGIIILRSCKINRDYSFLDYI
LGGCQLMFTVGIDFTASNGNPLDPSSLHYINPMGTNEYLSAIWAVGQIIQDYDSDKMFPA
LGFGAQLPPDWKVSHEFAINFNPTNPFCSGVDGIAQAYSACLPHIRFYGPTNFSPIVNHV
ARFAAQATQQRTATQYFILLIITDGVISDMEETRHAVVQASKLPMSIIIVGVGNADFAAM
EFLDGDSRMLRSHTGEEAARDIVQFVPFREFRNAAKETLAKAVLAELPQQVVQYFKHKNL
PPTNSEPA
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggcccacatacccagtgggggtgccccagcagcgggggcagcccccatgggcccccag
tattgcgtgtgcaaggtggagctgtcagtgagtggccagaacctactggaccgggatgtt
acctccaagtccgaccccttctgtgtcctctttacagagaacaatggcagatggatcgag
tacgacaggacagaaaccgcgatcaacaacctcaaccccgccttctccaagaagttcgtg
cttgactaccacttcgaggaggtacagaagctcaagttcgcgctctttgaccaggacaag
tccagtatgcggctggacgagcatgacttcctgggccagttctcctgcagcctgggcacg
atcgtctccagcaagaagatcactaggcctctgctgctgctgaatgacaagcctgcgggg
aagggcttgattacgatcgctgcccaggagctgtccgacaaccgcgtcatcacactaagc
ctggcgggcaggaggctggacaagaaggacctctttgggaagtcagacccctttctggag
ttttataagccaggagacgatggcaagtggatgctggtccacaggactgaggtgatcaag
tacacactggaccctgtgtggaagccattcacagtgcccttggtgtccctgtgtgatggg
gacatggagaagcccatccaggtcatgtgctacgactatgacaatgacgggggccatgac
ttcatcggcgagttccagacctcagtgtcacagatgtgtgaggctcgagacagcgtcccg
ctggagttcgagtgcatcaaccccaagaagcagaggaagaagaagaactataaaaactcg
ggcatcatcatcctgcgatcctgcaagataaaccgagactactccttccttgactacatc
ctgggaggctgccagctcatgttcaccgttggaatagactttacagcctccaacgggaat
cccctcgacccttcctctttgcactatatcaaccctatgggcaccaacgaatatctgtcg
gccatctgggctgttgggcagatcattcaggactacgacagtgataagatgtttccagct
ctgggattcggggcccagttacccccagactggaaggtctcccatgagtttgccatcaac
ttcaaccccaccaaccccttctgctcaggtgtggatggtattgcccaggcgtactcagct
tgcctgccccacatccgcttctacggtcctaccaatttctcccccatcgtcaaccacgtg
gcccggtttgcggcccaggccacacaacagcggacggccacgcagtacttcatcctcctc
atcatcacggacggggtcatcagtgacatggaggagacacggcatgccgtggtgcaggct
tccaagctgcccatgtccatcatcatcgtgggcgtgggcaatgcggacttcgctgccatg
gagttcctggatggggacagccgcatgctgcgctcccacacgggggaggaggcagcccgc
gatattgtgcagttcgttccctttcgagagttccgcaacgcagcaaaagagaccttggcc
aaagctgtgctggcggagctgccccaacaagttgtgcagtatttcaagcataaaaacctg
ccccccaccaactcggagcccgcctga

DBGET integrated database retrieval system