KEGG   Homo sapiens (human): 2212Help
Entry
2212              CDS       T01001                                 

Gene name
FCGR2A, CD32, CD32A, CDw32, FCG2, FCGR2, FCGR2A1, FcGR, IGFR2
Definition
(RefSeq) Fc fragment of IgG receptor IIa
  KO
K06472  low affinity immunoglobulin gamma Fc receptor II-a
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04380  Osteoclast differentiation
hsa04611  Platelet activation
hsa04666  Fc gamma R-mediated phagocytosis
hsa05140  Leishmaniasis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05322  Systemic lupus erythematosus
Disease
H00080  Systemic lupus erythematosus
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    2212 (FCGR2A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    2212 (FCGR2A)
   04666 Fc gamma R-mediated phagocytosis
    2212 (FCGR2A)
  09158 Development
   04380 Osteoclast differentiation
    2212 (FCGR2A)
 09160 Human Diseases
  09163 Immune diseases
   05322 Systemic lupus erythematosus
    2212 (FCGR2A)
  09171 Infectious diseases: Bacterial
   05150 Staphylococcus aureus infection
    2212 (FCGR2A)
   05152 Tuberculosis
    2212 (FCGR2A)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    2212 (FCGR2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2212 (FCGR2A)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2212 (FCGR2A)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    2212 (FCGR2A)
CD molecules [BR:hsa04090]
 Proteins
  2212 (FCGR2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig I-set Ig_4 Ig_5 DUF3827 ECSCR V-set_CD47
Motif
Other DBs
NCBI-GeneID: 2212
NCBI-ProteinID: NP_001129691
OMIM: 146790
HGNC: 3616
Ensembl: ENSG00000143226
Vega: OTTHUMG00000034469
Pharos: P12318(Tbio)
UniProt: P12318
Structure
PDB: 

Position
1q23.3
AA seq 317 aa AA seqDB search
MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTL
TCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVL
SEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHS
HSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIY
CRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDD
KNIYLTLPPNDHVNSNN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgactatggagacccaaatgtctcagaatgtatgtcccagaaacctgtggctgcttcaa
ccattgacagttttgctgctgctggcttctgcagacagtcaagctgcagctcccccaaag
gctgtgctgaaacttgagcccccgtggatcaacgtgctccaggaggactctgtgactctg
acatgccagggggctcgcagccctgagagcgactccattcagtggttccacaatgggaat
ctcattcccacccacacgcagcccagctacaggttcaaggccaacaacaatgacagcggg
gagtacacgtgccagactggccagaccagcctcagcgaccctgtgcatctgactgtgctt
tccgaatggctggtgctccagacccctcacctggagttccaggagggagaaaccatcatg
ctgaggtgccacagctggaaggacaagcctctggtcaaggtcacattcttccagaatgga
aaatcccagaaattctcccatttggatcccaccttctccatcccacaagcaaaccacagt
cacagtggtgattaccactgcacaggaaacataggctacacgctgttctcatccaagcct
gtgaccatcactgtccaagtgcccagcatgggcagctcttcaccaatggggatcattgtg
gctgtggtcattgcgactgctgtagcagccattgttgctgctgtagtggccttgatctac
tgcaggaaaaagcggatttcagccaattccactgatcctgtgaaggctgcccaatttgag
ccacctggacgtcaaatgattgccatcagaaagagacaacttgaagaaaccaacaatgac
tatgaaacagctgacggcggctacatgactctgaaccccagggcacctactgacgatgat
aaaaacatctacctgactcttcctcccaacgaccatgtcaacagtaataactaa

DBGET integrated database retrieval system