KEGG   Homo sapiens (human): 221223
Entry
221223            CDS       T01001                                 

Gene name
CES5A, CAUXIN, CES4C1, CES5, CES7, HEL126
Definition
(RefSeq) carboxylesterase 5A
  KO
K15743  carboxylesterase 3/5 [EC:3.1.1.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    221223 (CES5A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     221223 (CES5A)
SSDB
Motif
Pfam: COesterase Abhydrolase_3 Peptidase_S9 Esterase
Other DBs
NCBI-GeneID: 221223
NCBI-ProteinID: NP_001137157
OMIM: 618678
HGNC: 26459
Ensembl: ENSG00000159398
Vega: OTTHUMG00000133236
Pharos: Q6NT32(Tbio)
UniProt: Q6NT32
Position
16q12.2
AA seq 575 aa
MSGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSPVPVNVFLGV
PFAAPPLGSLRFTNPQPASPWDNLREATSYPNLCLQNSEWLLLDQHMLKVHYPKFGVSED
CLYLNIYAPAHADTGSKLPVLVWFPGGAFKTGSASIFDGSALAAYEDVLVVVVQYRLGIF
GFFTTWDQHAPGNWAFKDQVAALSWVQKNIEFFGGDPSSVTIFGESAGAISVSSLILSPM
AKGLFHKAIMESGVAIIPYLEAHDYEKSEDLQVVAHFCGNNASDSEALLRCLRTKPSKEL
LTLSQKTKSFTRVVDGAFFPNEPLDLLSQKAFKAIPSIIGVNNHECGFLLPMKEAPEILS
GSNKSLALHLIQNILHIPPQYLHLVANEYFHDKHSLTEIRDSLLDLLGDVFFVVPALITA
RYHRDAGAPVYFYEFRHRPQCFEDTKPAFVKADHADEVRFVFGGAFLKGDIVMFEGATEE
EKLLSRKMMKYWATFARTGNPNGNDLSLWPAYNLTEQYLQLDLNMSLGQRLKEPRVDFWT
STIPLILSASDMLHSPLSSLTFLSLLQPFFFFCAP
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgagtgggaattgggtgcacccaggccagatcctaatttgggctatctgggtccttgca
gcccccaccaaagggccttctgctgaagggccacagaggaacaccaggctgggatggatt
cagggcaagcaagtcactgtgctgggaagccctgtgcctgtgaacgtgttcctcggagtc
ccctttgctgctcccccgctgggatccctgcgatttacgaacccgcagcctgcatcgccc
tgggataacttgcgagaagccacctcctaccctaatttgtgcctccagaactcagagtgg
ctgctcttagatcaacatatgctcaaggtgcattacccgaaattcggagtgtcagaagac
tgcctctacctgaacatctatgcgcctgcccacgccgatacaggctccaagctccccgtc
ttggtgtggttcccaggaggtgccttcaagactggctcagcctccatctttgatgggtcc
gccctggctgcctatgaggacgtgctggttgtggtcgtccagtaccggctaggaatattt
ggtttcttcaccacatgggatcagcatgctccggggaactgggccttcaaggaccaggtg
gctgctctgtcctgggtccagaagaacatcgagttcttcggtggggaccccagctctgtg
accatctttggcgagtccgcgggagccataagtgtttctagtcttatactgtctcccatg
gccaaaggcttattccacaaagccatcatggagagtggggtggccatcatcccttacctg
gaggcccatgattatgagaagagtgaggacctgcaggtggttgcacatttctgtggtaac
aatgcgtcagactctgaggccctgctgaggtgcctgaggacaaaaccctccaaggagctg
ctgaccctcagccagaaaacaaagtctttcactcgagtggttgatggtgctttctttcct
aatgagcctctagatctattgtctcagaaagcatttaaagcaattccttccatcatcgga
gtcaataaccacgagtgtggcttcctgctgcctatgaaggaggctcctgagatcctcagt
ggctccaacaagtcccttgccctccatctgatacaaaacatcctgcacatcccgcctcag
tatttgcaccttgtggctaatgaatacttccatgacaagcactccctgactgaaatccga
gacagtcttctggacttgcttggagatgtgttctttgtggtccctgcactgatcacagct
cgatatcacagagatgctggtgcacctgtctacttctatgagtttcggcaccggcctcag
tgctttgaagacacgaagccagcttttgtcaaagccgaccacgctgatgaagtccgcttt
gtgttcggtggtgccttcctgaagggggacattgttatgttcgaaggagccacggaggag
gagaagttactgagccggaagatgatgaaatactgggctacctttgctcgaaccgggaat
cctaatgggaacgacctgtctctgtggccagcttataatctgactgagcagtacctccag
ctggacttgaacatgagcctcggacagagactcaaagaaccgcgggtggatttttggacc
agcaccatccccctgatcctgtctgcctccgacatgctccacagtcctctttcttcctta
actttcctctctctcctccagcctttctttttcttttgtgctccttga

DBGET integrated database retrieval system