KEGG   Homo sapiens (human): 221301
Entry
221301            CDS       T01001                                 
Symbol
CALHM4, C6orf78, FAM26D
Name
(RefSeq) calcium homeostasis modulator family member 4
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Ca_hom_mod
Other DBs
NCBI-GeneID: 221301
NCBI-ProteinID: NP_001243816
HGNC: 21094
Ensembl: ENSG00000164451
Pharos: Q5JW98(Tdark)
UniProt: Q5JW98
Structure
Position
6:116529043..116561127
AA seq 171 aa
MFDNVSASKREEILAGFPCCRSAPSDVILVRDEIALLHRYQSQMLGWILITLATIAALVS
CCVAKCCSPLTSLQHCYWTSHLQNERELFEQAAEQHSRLLMMHRIKKLFGFIPGSEDVKH
IRIPSCQDWKDISVPTLLCMGDDLQGHYSFLGNRVDEDNEEDRSRGIELKP
NT seq 516 nt   +upstreamnt  +downstreamnt
atgtttgataatgtcagtgccagcaaacgagaagagatcctggctgggtttccatgttgc
agatcagctccttctgacgtgatcctagtaagagatgaaatagctcttctgcacagatac
cagtcacagatgctgggttggattttgatcaccttggcaaccattgctgccttagtctcc
tgctgtgtggcaaagtgctgctctcccctcacctctctgcaacattgctactggaccagc
cacctccagaatgagagagaactctttgaacaagcagcagagcagcactctcggctcctc
atgatgcatcgcataaagaagctatttggcttcattcccgggagtgaagacgtcaaacac
atccgcattccttcttgtcaggactggaaagatatttcagtacccactcttttatgcatg
ggtgatgacttgcaaggtcactatagcttccttggaaatagggtggatgaggataatgag
gaagacagatcaagaggtattgaattaaaaccttga

DBGET integrated database retrieval system