KEGG   Homo sapiens (human): 221303
Entry
221303            CDS       T01001                                 
Symbol
FAM162B, C6orf189, bA86F4.2
Name
(RefSeq) family with sequence similarity 162 member B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF1075 DUF1673
Other DBs
NCBI-GeneID: 221303
NCBI-ProteinID: NP_001078949
HGNC: 21549
Ensembl: ENSG00000183807
Pharos: Q5T6X4(Tdark)
UniProt: Q5T6X4
Position
6:complement(116752197..116765719)
AA seq 162 aa
MLRAVGSLLRLGRGLTVRCGPGAPLEATRRPAPALPPRGLPCYSSGGAPSNSGPQGHGEI
HRVPTQRRPSQFDKKILLWTGRFKSMEEIPPRIPPEMIDTARNKARVKACYIMIGLTIIA
CFAVIVSAKRAVERHESLTSWNLAKKAKWREEAALAAQAKAK
NT seq 489 nt   +upstreamnt  +downstreamnt
atgctcagggcggtcgggagcctactgcgccttggccgcgggctaacagtccgctgcggc
cccggggcgcctctcgaggccacgcgacggcccgcaccggctcttccgccccggggtctc
ccctgctactccagcggcggggcccccagcaattctgggccccaaggtcacggggagatt
caccgagtccccacgcagcgcaggccttcgcagttcgacaagaaaatcctgctgtggaca
gggcgtttcaaatcgatggaggagatcccgcctcggatcccgccagaaatgatagacacc
gcaagaaacaaagctcgagtgaaagcttgttacataatgattggactcacaattatcgcc
tgctttgctgtgatagtgtcagccaaaagggctgtagaacgacatgaatccttaacaagt
tggaacttggcaaagaaagctaagtggcgtgaagaagctgcattggctgcacaggctaaa
gctaaatga

DBGET integrated database retrieval system