KEGG   Homo sapiens (human): 221443
Entry
221443            CDS       T01001                                 
Symbol
OARD1, C6orf130, TARG1, dJ34B21.3
Name
(RefSeq) O-acyl-ADP-ribose deacylase 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Macro PSII_Pbs27 3HCDH_N
Other DBs
NCBI-GeneID: 221443
NCBI-ProteinID: NP_001316613
OMIM: 614393
HGNC: 21257
Ensembl: ENSG00000124596
Pharos: Q9Y530(Tdark)
UniProt: Q9Y530 A0A024RCY9
Structure
Position
6:complement(41064772..41097787)
AA seq 152 aa
MASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLN
QQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRI
GCGLDRLQWENVSAMIEEVFEATDIKITVYTL
NT seq 459 nt   +upstreamnt  +downstreamnt
atggccagcagccttaatgaagatccagaaggaagcagaatcacttatgtgaaaggagac
ctttttgcatgcccgaaaacagactctttagcccactgtatcagtgaggattgtcgcatg
ggcgctgggatagctgtcctctttaagaagaaatttggaggggtgcaagaacttttaaat
caacaaaagaaatctggagaagtggctgttctgaagagagatgggcgatatatatattac
ttgattacaaagaaaagggcttcgcacaagccaacttatgaaaacttacagaagagttta
gaggcaatgaagtctcattgtctgaagaatggagtcactgacctctccatgcccaggatt
ggatgtggtcttgatcgtctgcaatgggaaaatgtatctgcgatgatcgaggaggtattt
gaggcaacagacatcaaaattactgtgtacacactctga

DBGET integrated database retrieval system