KEGG   Homo sapiens (human): 221613
Entry
221613            CDS       T01001                                 

Gene name
H2AC1, H2AA, H2AFR, HIST1H2AA, TH2A, bA317E16.2
Definition
(RefSeq) H2A clustered histone 1
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    221613 (H2AC1)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    221613 (H2AC1)
  09165 Substance dependence
   05034 Alcoholism
    221613 (H2AC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    221613 (H2AC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    221613 (H2AC1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    221613 (H2AC1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   221613 (H2AC1)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 221613
NCBI-ProteinID: NP_734466
OMIM: 613499
HGNC: 18729
Ensembl: ENSG00000164508
Vega: OTTHUMG00000014407
Pharos: Q96QV6(Tdark)
UniProt: Q96QV6
Structure
PDB: 
5GT0 5GSU

Position
6p22.2
AA seq 131 aa
MSGRGKQGGKARAKSKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLT
AEILELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TESHHHKAQSK
NT seq 396 nt   +upstreamnt  +downstreamnt
atgtctggacgagggaagcagggaggaaaagcacgcgccaagtctaagtctcgctcttct
agagcgggtttgcagtttcccgtaggccggatccatcgtctgcttcgtaagggaaactat
gcagagcggataggggcaggcgcaccagtgtatttggcggcagtgttagagtatctcaca
gcagaaatccttgagctggcaggcaatgcgtctcgcgataacaaaaaaactcgcattatt
ccccgccacctgcagctagcgatccgcaatgatgaggaactcaataagcttttgggcggc
gtgaccattgcccagggcggagtcctgcctaacattcaggcagtgctgctgcccaagaag
actgagagtcaccaccataaagcccaaagcaagtaa

DBGET integrated database retrieval system