KEGG   Homo sapiens (human): 221656
Entry
221656            CDS       T01001                                 

Gene name
KDM1B, AOF1, C6orf193, LSD2
Definition
(RefSeq) lysine demethylase 1B
  KO
K19413  lysine-specific histone demethylase 1B [EC:1.-.-.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    221656 (KDM1B)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     221656 (KDM1B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    221656 (KDM1B)
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 zf-CW Pyr_redox_2 Thi4 Pyr_redox_3 FAD_binding_3 HI0933_like Pyr_redox DAO Lycopene_cycl FAD_binding_2 NAD_binding_9 FAD_oxidored GIDA 2-Hacid_dh_C AlaDh_PNT_C NAD_binding_7 zf-RING_2 IlvN zf-C3HC4 Shikimate_DH YjeF_N TrkA_N
Other DBs
NCBI-GeneID: 221656
NCBI-ProteinID: NP_694587
OMIM: 613081
HGNC: 21577
Ensembl: ENSG00000165097
Vega: OTTHUMG00000014316
Pharos: Q8NB78(Tbio)
UniProt: Q8NB78
Structure
PDB: 

Position
6p22.3
AA seq 590 aa
MATPRGRTKKKASFDHSPDSLPLRSSGRQAKKKATETTDEDEDGGSEKKYRKCEKAGCTA
TCPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYRSHKDGYDKYTTWKKIWTSN
GKTEPSPKAFMADQQLPYWVQCTKPECRKWRQLTKEIQLTPQIAKTYRCGMKPNTAIKPE
TSDHCSLPEDLEALTPQKCIPHIIVRGLVRIRCVQEVERILYFMTRKGLINTGVLSVGAD
QYLLPKDYHNKSVIIIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGRVWDDKSFKGVTV
GRGAQIVNGCINNPVALMCEQVSARSWDHNEFFAQFAGDHTLLTPGYSVIIEKLAEGLDI
QLKSPVQCIDYSGDEVQVTTTDGTGYSAQKVLVTVPLALLQKGAIQFNPPLSEKKMKAIN
SLGAGIIEKIALQFPYRFWDSKVQGADFFGHVPPSASKRGLFAVFYDMDPQKKHSVLMSV
IAGEAVASVRTLDDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFVKT
GGSGEAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggcaactccacgggggaggacaaagaaaaaagcatcttttgatcattctccggatagc
cttcctttgaggagctccggtaggcaggcgaagaagaaagcaacagagacaacagatgag
gatgaagatggtggctcagagaagaagtacaggaaatgtgaaaaggcaggctgtacggca
acatgtcctgtgtgctttgcaagtgcttctgaaagatgtgccaaaaatggctacacctcc
cgatggtatcatctctcctgtggggaacatttctgtaatgaatgctttgaccattactac
agaagccataaggatggatatgacaaatatactacatggaaaaaaatatggactagcaat
ggcaaaaccgaacctagtcccaaagctttcatggcagaccagcaactcccctactgggtt
cagtgtacaaaacctgagtgtagaaaatggaggcagcttaccaaggaaatccagcttact
ccacagatagccaagacttatcgatgcggtatgaaaccaaatactgctattaagcctgag
acctcagatcattgttccctcccagaggatctagaagctcttactcctcagaaatgtatt
cctcacatcatcgtccggggtctcgtgcgtattcgatgcgttcaggaagtggagagaata
ctgtattttatgaccagaaaaggtctcatcaacactggagttctcagcgtgggagccgac
cagtatcttctccctaaggactaccacaataaatcagtcatcattatcggggctggtcca
gcaggattagcagctgctaggcaactgcataactttggaattaaggtgactgtcctggaa
gccaaagacagaattggaggccgagtctgggatgataaatcttttaaaggcgtcacagtg
ggaagaggagctcagattgtcaatgggtgtattaacaacccagtagcattaatgtgtgaa
caagtatctgctcgctcgtgggaccacaatgaattctttgcccagtttgctggtgaccac
actctgctaactcccgggtactcggtgataattgaaaaactggcagaagggcttgacatt
caactcaaatctccagtgcagtgtattgattattctggagatgaagtgcaggttaccact
acagatggcacagggtattctgcacaaaaggtattagtcactgtaccactggctttacta
cagaaaggtgccattcagtttaatccaccgttgtcagagaagaagatgaaggctatcaac
agcttaggcgcaggcatcattgaaaagattgccttgcaatttccgtatagattttgggac
agtaaagtacaaggggctgacttttttggtcacgttcctcccagtgccagcaagcgaggg
ctttttgccgtgttctatgacatggatccccagaagaagcacagcgtgctgatgtctgtg
attgccggggaggctgtcgcatccgtgaggaccctggatgacaaacaggtgctgcagcag
tgcatggccacgctccgggagctgttcaaggagcaggaggtcccagatcccacaaagtat
tttgtcactcggtggagcacagacccatggatccagatggcatacagttttgtgaagaca
ggtggaagtggggaggcctacgatatcattgctgaagacattcaaggaaccgtctttttc
gctggtgaggcaacaaacaggcatttcccacaaactgttacaggggcatatttgagtggc
gttcgagaagcaagcaagattgcagcattttaa

DBGET integrated database retrieval system