KEGG   Homo sapiens (human): 2217Help
Entry
2217              CDS       T01001                                 

Gene name
FCGRT, FCRN, alpha-chain
Definition
(RefSeq) Fc fragment of IgG receptor and transporter
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set MHC_I_3
Motif
Other DBs
NCBI-GeneID: 2217
NCBI-ProteinID: NP_001129491
OMIM: 601437
HGNC: 3621
Ensembl: ENSG00000104870
Vega: OTTHUMG00000183155
Pharos: P55899(Tchem)
UniProt: P55899 A0A024QZI2
Structure
PDB: 

Position
19q13.33
AA seq 365 aa AA seqDB search
MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLS
YNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCE
LGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLF
SCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGL
AAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLV
VGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNV
IPATA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgggggtcccgcggcctcagccctgggcgctggggctcctgctctttctccttcctggg
agcctgggcgcagaaagccacctctccctcctgtaccaccttaccgcggtgtcctcgcct
gccccggggactcctgccttctgggtgtccggctggctgggcccgcagcagtacctgagc
tacaatagcctgcggggcgaggcggagccctgtggagcttgggtctgggaaaaccaggtg
tcctggtattgggagaaagagaccacagatctgaggatcaaggagaagctctttctggaa
gctttcaaagctttggggggaaaaggtccctacactctgcagggcctgctgggctgtgaa
ctgggccctgacaacacctcggtgcccaccgccaagttcgccctgaacggcgaggagttc
atgaatttcgacctcaagcagggcacctggggtggggactggcccgaggccctggctatc
agtcagcggtggcagcagcaggacaaggcggccaacaaggagctcaccttcctgctattc
tcctgcccgcaccgcctgcgggagcacctggagaggggccgcggaaacctggagtggaag
gagcccccctccatgcgcctgaaggcccgacccagcagccctggcttttccgtgcttacc
tgcagcgccttctccttctaccctccggagctgcaacttcggttcctgcggaatgggctg
gccgctggcaccggccagggtgacttcggccccaacagtgacggatccttccacgcctcg
tcgtcactaacagtcaaaagtggcgatgagcaccactactgctgcattgtgcagcacgcg
gggctggcgcagcccctcagggtggagctggaatctccagccaagtcctccgtgctcgtg
gtgggaatcgtcatcggtgtcttgctactcacggcagcggctgtaggaggagctctgttg
tggagaaggatgaggagtgggctgccagccccttggatctcccttcgtggagacgacacc
ggggtcctcctgcccaccccaggggaggcccaggatgctgatttgaaggatgtaaatgtg
attccagccaccgcctga

DBGET integrated database retrieval system