KEGG   Homo sapiens (human): 2217
Entry
2217              CDS       T01001                                 
Symbol
FCGRT, FCRN, FcgammaRn, alpha-chain
Name
(RefSeq) Fc gamma receptor and transporter
  KO
K24019  IgG receptor FcRn large subunit p51
Organism
hsa  Homo sapiens (human)
Drug target
Batoclimab: D11983
Efgartigimod alfa: D11876<JP/US>
Nipocalimab: D11666
Orilanolimab: D12144
Rozanolixizumab: D12182
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2217 (FCGRT)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    2217 (FCGRT)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_3
Other DBs
NCBI-GeneID: 2217
NCBI-ProteinID: NP_001129491
OMIM: 601437
HGNC: 3621
Ensembl: ENSG00000104870
Pharos: P55899(Tchem)
UniProt: P55899 A0A024QZI2
Structure
Position
19:49512661..49526428
AA seq 365 aa
MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLS
YNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCE
LGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLF
SCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGL
AAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLV
VGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNV
IPATA
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgggggtcccgcggcctcagccctgggcgctggggctcctgctctttctccttcctggg
agcctgggcgcagaaagccacctctccctcctgtaccaccttaccgcggtgtcctcgcct
gccccggggactcctgccttctgggtgtccggctggctgggcccgcagcagtacctgagc
tacaatagcctgcggggcgaggcggagccctgtggagcttgggtctgggaaaaccaggtg
tcctggtattgggagaaagagaccacagatctgaggatcaaggagaagctctttctggaa
gctttcaaagctttggggggaaaaggtccctacactctgcagggcctgctgggctgtgaa
ctgggccctgacaacacctcggtgcccaccgccaagttcgccctgaacggcgaggagttc
atgaatttcgacctcaagcagggcacctggggtggggactggcccgaggccctggctatc
agtcagcggtggcagcagcaggacaaggcggccaacaaggagctcaccttcctgctattc
tcctgcccgcaccgcctgcgggagcacctggagaggggccgcggaaacctggagtggaag
gagcccccctccatgcgcctgaaggcccgacccagcagccctggcttttccgtgcttacc
tgcagcgccttctccttctaccctccggagctgcaacttcggttcctgcggaatgggctg
gccgctggcaccggccagggtgacttcggccccaacagtgacggatccttccacgcctcg
tcgtcactaacagtcaaaagtggcgatgagcaccactactgctgcattgtgcagcacgcg
gggctggcgcagcccctcagggtggagctggaatctccagccaagtcctccgtgctcgtg
gtgggaatcgtcatcggtgtcttgctactcacggcagcggctgtaggaggagctctgttg
tggagaaggatgaggagtgggctgccagccccttggatctcccttcgtggagacgacacc
ggggtcctcctgcccaccccaggggaggcccaggatgctgatttgaaggatgtaaatgtg
attccagccaccgcctga

DBGET integrated database retrieval system