KEGG   Homo sapiens (human): 221749
Entry
221749            CDS       T01001                                 
Symbol
PXDC1, C6orf145
Name
(RefSeq) PX domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF6545
Other DBs
NCBI-GeneID: 221749
NCBI-ProteinID: NP_899229
HGNC: 21361
Ensembl: ENSG00000168994
Vega: OTTHUMG00000014146
Pharos: Q5TGL8(Tdark)
UniProt: Q5TGL8
Position
6:complement(3722619..3751713)
AA seq 231 aa
MASAVFEGTSLVNMFVRGCWVNGIRRLIVSRRGDEEEFFEIRTEWSDRSVLYLHRSLADL
GRLWQRLRDAFPEDRSELAQGPLRQGLVAIKEAHDIETRLNEVEKLLKTIISMPCKYSRS
EVVLTFFERSPLDQVLKNDNVHKIQPSFQSPVKISEIMRSNGFCLANTETIVIDHSIPNG
RDQQLGVDPTEHLFENGSEFPSELEDGDDPAAYVTNLSYYHLVPFETDIWD
NT seq 696 nt   +upstreamnt  +downstreamnt
atggcctcggcggtgtttgagggcacgtcgctcgtgaacatgttcgtgcgcggctgctgg
gtgaacggcatccgcaggctcatcgtcagccggcgcggcgacgaagaggagttcttcgag
atccgcacggagtggtcggaccgcagcgtgctctacctgcaccgcagcctggcggacctg
ggccgcctgtggcagcgcctgcgcgacgcctttcccgaggaccggtccgaactggcgcag
gggccgctgcggcaaggactggttgccataaaggaagcccacgacatagagaccaggctt
aatgaggtggagaagctgctgaagacgatcataagcatgccctgtaaatattctagatcg
gaagttgtgctcaccttcttcgaaagatctcctctggatcaggtgttaaaaaatgataat
gtgcataaaattcaacccagctttcaaagtccagtcaaaatatcagaaatcatgaggtcc
aatggattttgtttagcaaataccgaaacaatagttattgaccacagtataccaaatgga
agagaccagcagctgggcgtggacccaacagagcatttatttgagaatggcagtgagttt
ccctcagagctggaggacggggacgacccagcagcctacgtcaccaacctgtcatattac
cacctggtccccttcgagacagacatttgggactga

DBGET integrated database retrieval system