KEGG   Homo sapiens (human): 221833Help
Entry
221833            CDS       T01001                                 

Gene name
SP8, BTD
Definition
(RefSeq) Sp8 transcription factor
  KO
K09198  transcription factor Sp8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    221833 (SP8)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 ubiquitous factors
    221833 (SP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-Di19 zf-C2H2_jaz zf-met Zn-C2H2_12 zf-C2H2_8 zf-C2H2_6 zf-H2C2_5
Motif
Other DBs
NCBI-GeneID: 221833
NCBI-ProteinID: NP_945194
OMIM: 608306
HGNC: 19196
Ensembl: ENSG00000164651
Vega: OTTHUMG00000094788
Pharos: Q8IXZ3(Tdark)
UniProt: Q8IXZ3 A8K350
Position
7p21.1
AA seq 490 aa AA seqDB search
MLAATCNKIGSPSPSPSSLSDSSSSFGKGFHPWKRSSSSSSASCNVVGSSLSSFGVSGAS
RNGGSSSAAAAAAAAAAAAAALVSDSFSCGGSPGSSAFSLTSSSAAAAAAAAAAAASSSP
FANDYSVFQAPGVSGGSGGGGGGGGGGSSAHSQDGSHQPVFISKVHTSVDGLQGIYPRVG
MAHPYESWFKPSHPGLGAAGEVGSAGASSWWDVGAGWIDVQNPNSAAALPGSLHPAAGGL
QTSLHSPLGGYNSDYSGLSHSAFSSGASSHLLSPAGQHLMDGFKPVLPGSYPDSAPSPLA
GAGGSMLSAGPSAPLGGSPRSSARRYSGRATCDCPNCQEAERLGPAGASLRRKGLHSCHI
PGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPV
CNKRFMRSDHLSKHVKTHSGGGGGGGSAGSGSGGKKGSDTDSEHSAAGSPPCHSPELLQP
PEPGHRNGLE
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccgctacctgtaataagataggcagccccagcccgtctccctcctccctctcg
gacagctcttcttccttcggcaaaggcttccacccctggaaacgctcctcgtcctcttct
tccgccagctgcaacgtagtgggttccagtctctcaagcttcggcgtgtccggggcctcc
aggaacggcggctcgtcctcggcggctgcggcggccgcggcagcagccgcggctgccgcg
gccctggtgtccgactcgttcagctgcggcggctcgcctggctccagcgccttctccctc
acctccagcagcgccgcagccgccgccgccgccgccgcagccgccgcctccagctcgccc
ttcgccaacgactactctgttttccaggcccccggagtttccgggggcagcggcggcggc
ggcgggggcggcggcggcggctcctccgcgcactcgcaggacggctcccaccagccggtg
ttcatctccaaggtgcacacctctgtggacgggctgcagggcatctacccgcgggtgggc
atggcgcacccgtacgagtcgtggtttaagccctcgcacccgggcctgggtgctgcgggc
gaggtgggctcggccggcgcctccagctggtgggacgtgggggccggctggatcgacgtg
cagaacccgaacagcgcggctgcgctgcccggctcgctgcaccctgccgccggggggctc
caaacctcgctgcactcgccgctcggaggctacaactcggattactcgggcctgagtcac
tcggccttcagcagcggcgcctcctcgcacctgctcagccccgccgggcagcacctcatg
gacggcttcaagccagtgctacccggctcctacccggactcggccccgtcgccgctggcc
ggcgcggggggctccatgttgagcgctgggccttcggcgccgctggggggctccccgcgc
tcctcagctcgccgctactccggccgcgccacctgcgactgccccaactgccaggaggca
gagcggctgggccctgccggggcgagcttgcggcgcaagggcctgcacagctgccacatc
ccgggctgcggcaaggtgtacggcaagacttcgcacctcaaggcgcacctgcgctggcac
acgggcgagcggcccttcgtgtgcaactggcttttctgcggcaagcgcttcacgcgctcc
gacgagctgcagcggcacctgcggacccacaccggcgagaagcgcttcgcctgtccagtt
tgcaacaagcgcttcatgcgcagcgaccacctcagcaagcacgtgaagacgcacagtggc
ggcggcggcggcggcggctcggcgggctcgggcagcggcggcaagaagggcagcgacacc
gacagcgagcacagcgccgcgggcagcccgccctgccactccccagagctgctgcagccc
cccgagcccgggcaccgcaacggcctagagtga

DBGET integrated database retrieval system