KEGG   Homo sapiens (human): 2219Help
Entry
2219              CDS       T01001                                 

Gene name
FCN1, FCNM
Definition
(RefSeq) ficolin 1
  KO
K10104  ficolin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    2219 (FCN1)
Lectins [BR:hsa04091]
 Ficolins
  2219 (FCN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C Collagen
Motif
Other DBs
NCBI-GeneID: 2219
NCBI-ProteinID: NP_001994
OMIM: 601252
HGNC: 3623
Ensembl: ENSG00000085265
Vega: OTTHUMG00000020895
Pharos: O00602(Tbio)
UniProt: O00602
Structure
PDB: 

Position
9q34.3
AA seq 326 aa AA seqDB search
MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAP
GPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKD
LLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFG
SQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFV
GGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESY
ANGINWSAAKGYKYSYKVSEMKVRPA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggagctgagtggagccaccatggcccgggggctcgctgtcctgctagtcttgttcctg
catatcaagaacctgcctgcccaggctgcggacacatgtccagaggtgaaggtggtgggc
ctggagggctctgacaagctcaccattctccgaggctgcccggggctgcccggggcccca
gggccaaagggagaggcaggtgtcattggagagagaggagaacgcggtctccctggagcc
cctggaaaggcaggaccagtggggcccaaaggagaccgaggagagaaggggatgcgtgga
gagaaaggagacgctgggcagtctcagtcgtgtgcgacaggcccacgcaactgcaaggac
ctgctagaccgggggtatttcctgagcggctggcacaccatctacctgcccgactgccgg
cccctgactgtgctctgtgacatggacacggacggagggggctggaccgttttccagcgg
aggatggatggctctgtggacttctatcgggactgggccgcatacaagcagggcttcggc
agtcagctgggggagttctggctggggaatgacaacatccacgccctgactgcccaggga
agcagcgagctccgtgtagacctggtggactttgagggcaaccaccagtttgctaagtac
aaatcattcaaggtggctgacgaggcagagaagtacaagctggtactgggagcctttgtc
gggggcagtgcgggtaattctctaacgggccacaacaacaacttcttctccaccaaagac
caagacaatgatgtgagttcttcgaattgtgctgagaagttccaaggagcctggtggtac
gccgactgtcatgcttcaaacctcaatggtctctacctcatgggaccccatgagagctat
gccaatggtatcaactggagtgcggcgaaggggtacaaatatagctacaaggtgtcagag
atgaaggtgcggcccgcctag

DBGET integrated database retrieval system