KEGG   Homo sapiens (human): 221914Help
Entry
221914            CDS       T01001                                 

Gene name
GPC2
Definition
(RefSeq) glypican 2
  KO
K08108  glypican 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    221914 (GPC2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    221914 (GPC2)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   221914 (GPC2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  221914 (GPC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glypican
Motif
Other DBs
NCBI-GeneID: 221914
NCBI-ProteinID: NP_689955
HGNC: 4450
Ensembl: ENSG00000213420
Vega: OTTHUMG00000154894
Pharos: Q8N158(Tbio)
UniProt: Q8N158
Position
7q22.1
AA seq 579 aa AA seqDB search
MSALRPLLLLLLPLCPGPGPGPGSEAKVTRSCAETRQVLGARGYSLNLIPPALISGEHLR
VCPQEYTCCSSETEQRLIRETEATFRGLVEDSGSFLVHTLAARHRKFDEFFLEMLSVAQH
SLTQLFSHSYGRLYAQHALIFNGLFSRLRDFYGESGEGLDDTLADFWAQLLERVFPLLHP
QYSFPPDYLLCLSRLASSTDGSLQPFGDSPRRLRLQITRTLVAARAFVQGLETGRNVVSE
ALKVPVSEGCSQALMRLIGCPLCRGVPSLMPCQGFCLNVVRGCLSSRGLEPDWGNYLDGL
LILADKLQGPFSFELTAESIGVKISEGLMYLQENSAKVSAQVFQECGPPDPVPARNRRAP
PPREEAGRLWSMVTEEERPTTAAGTNLHRLVWELRERLARMRGFWARLSLTVCGDSRMAA
DASLEAAPCWTGAGRGRYLPPVVGGSPAEQVNNPELKVDASGPDVPTRRRRLQLRAATAR
MKTAALGHDLDGQDADEDASGSGGGQQYADDWMAGAVAPPARPPRPPYPPRRDGSGGKGG
GGSARYNQGRSRSGGASIGFHTQTILILSLSALALLGPR
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgctgcgacctctcctgcttctgctgctgcctctgtgtcccggtcctggtccc
ggacccgggagcgaggcaaaggtcacccggagttgtgcagagacccggcaggtgctgggg
gcccggggatatagcttaaacctaatccctcccgccctgatctcaggtgagcacctccgg
gtctgtccccaggagtacacctgctgttccagtgagacagagcagaggctgatcagggag
actgaggccaccttccgaggcctggtggaggacagcggctcctttctggttcacacactg
gctgccaggcacagaaaatttgatgagttttttctggagatgctctcagtagcccagcac
tctctgacccagctcttctcccactcctacggccgcctgtatgcccagcacgccctcata
ttcaatggcctgttctctcggctgcgagacttctatggggaatctggtgaggggttggat
gacaccctggcggatttctgggcacagctcctggagagagtgttcccgctgctgcaccca
cagtacagcttcccccctgactacctgctctgcctctcacgcttggcctcatctaccgat
ggctctctgcagccctttggggactcaccccgccgcctccgcctgcagataacccggacc
ctggtggctgcccgagcctttgtgcagggcctggagactggaagaaatgtggtcagcgaa
gcgcttaaggtgccggtgtctgaaggctgcagccaggctctgatgcgtctcatcggctgt
cccctgtgccggggggtcccctcacttatgccctgccagggcttctgcctcaacgtggtt
cgtggctgtctcagcagcaggggactggagcctgactggggcaactatctggatggtctc
ctgatcctggctgataagctccagggccccttttcctttgagctgacggccgagtccatt
ggggtgaagatctcggagggtttgatgtacctgcaggaaaacagtgcgaaggtgtccgcc
caggtgtttcaggagtgcggcccccccgacccggtgcctgcccgcaaccgtcgagccccg
ccgccccgggaagaggcgggccggctgtggtcgatggtgaccgaggaggagcggcccacg
acggccgcaggcaccaacctgcaccggctggtgtgggagctccgcgagcgtctggcccgg
atgcggggcttctgggcccggctgtccctgacggtgtgcggagactctcgcatggcagcg
gacgcctcgctggaggcggcgccctgctggaccggagccgggcggggccggtacttgccg
ccagtggtcgggggctccccggccgagcaggtcaacaaccccgagctcaaggtggacgcc
tcgggccccgatgtcccgacacggcggcgtcggctacagctccgggcggccacggccaga
atgaaaacggccgcactgggacacgacctggacgggcaggacgcggatgaggatgccagc
ggctctggagggggacagcagtatgcagatgactggatggctggggctgtggctccccca
gcccggcctcctcggcctccataccctcctagaagggatggttctgggggcaaaggagga
ggtggcagtgcccgctacaaccagggccggagcaggagtgggggggcatctattggtttt
cacacccaaaccatcctcattctctccctctcagccctggccctgcttggacctcgataa

DBGET integrated database retrieval system