KEGG   Homo sapiens (human): 221937Help
Entry
221937            CDS       T01001                                 

Gene name
FOXK1, FOXK1L
Definition
(RefSeq) forkhead box K1
  KO
K09404  forkhead box protein K
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    221937 (FOXK1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix other regulators
    221937 (FOXK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Forkhead FHA
Motif
Other DBs
NCBI-GeneID: 221937
NCBI-ProteinID: NP_001032242
OMIM: 616302
HGNC: 23480
Ensembl: ENSG00000164916
Vega: OTTHUMG00000151739
Pharos: P85037(Tbio)
UniProt: P85037
Position
7p22.1
AA seq 733 aa AA seqDB search
MAEVGEDSGARALLALRSAPCSPVLCAAAAAAAFPAAAPPPAPAQPQPPPGPPPPPPPPL
PPGAIAGAGSSGGSSGVSGDSAVAGAAPALVAAAAASVRQSPGPALARLEGREFEFLMRQ
PSVTIGRNSSQGSVDLSMGLSSFISRRHLQLSFQEPHFYLRCLGKNGVFVDGAFQRRGAP
ALQLPKQCTFRFPSTAIKIQFTSLYHKEEAPASPLRPLYPQISPLKIHIPEPDLRSMVSP
VPSPTGTISVPNSCPASPRGAGSSSYRFVQNVTSDLQLAAEFAAKAASEQQADTSGGDSP
KDESKPPFSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLN
RYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPAS
PTHPGLMSPRSGGLQTPECLSREGSPIPHDPEFGSKLASVPEYRYSQSAPGSPVSAQPVI
MAVPPRPSSLVAKPVAYMPASIVTSQQPAGHAIHVVQQAPTVTMVRVVTTSANSANGYIL
TSQGAAGGSHDAAGAAVLDLGSEARGLEEKPTIAFATIPAAGGVIQTVASQMAPGVPGHT
VTILQPATPVTLGQHHLPVRAVTQNGKHAVPTNSLAGNAYALTSPLQLLATQASSSAPVV
VTRVCEVGPKEPAAAVAATATTTPATATTASASASSTGEPEVKRSRVEEPSGAVTTPAGV
IAAAGPQGPGTGE
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagtcggcgaggacagcggcgcccgcgccctgctcgcgctgcgctcggcgccc
tgcagcccagtgctgtgcgccgcagccgccgccgccgccttccccgcggccgcacccccg
ccggcccccgcgcagccccagcctccgcccgggccgccgccgccgccgccaccgccgctg
cctccgggcgcgatcgcgggcgcgggctcctccgggggctcctccggggtatccggggac
tccgcggtcgcgggcgcggcgccggccctggtggccgcggcggccgcctcggtacggcag
agcccggggccggcgctggcgcggctggagggccgcgagttcgagttcctcatgcgccag
cccagcgtcaccatcggccgcaactcgtcgcagggctcggtggacttgagcatgggcctg
tccagcttcatctcgcggcgccacctgcagctcagcttccaggagccgcacttctacctg
cgctgcctcggcaagaacggcgtcttcgtggacggggccttccagagacgcggcgcgccc
gccctgcagctgcccaagcagtgtaccttccggtttcccagcacggccatcaagatccag
ttcacgtcgctctatcacaaagaagaggccccagcctccccgctgcggccactgtacccc
cagatctcccctctgaagatccacatcccggagccggacctccggagcatggtcagcccc
gtcccctccccgacgggcaccatcagtgtccccaactcctgcccagccagtccacgcggt
gccggctcctccagttaccgctttgtgcagaacgtgacctcggacctgcagctggcagca
gagtttgcagcaaaggccgcgtcggagcagcaggcagacacgtctggaggagacagcccc
aaggatgagtcaaagccgccgttctcctacgcgcagctgatcgtgcaggccatctcctcc
gcccaggaccggcagctgaccctgagcgggatctacgcccacatcaccaagcattacccc
tactaccggacggccgacaaaggctggcagaattctatccggcacaacctctctttgaac
cgttactttatcaaagtcccacgttcccaggaggagcctgggaaggggtccttttggcga
atagaccctgcctctgaagccaagctcgtggaacaggcattccggaaacggaggcagagg
ggtgtctcctgcttccgcacccccttcgggcctctgtcctcaaggagcgctccagcttcg
cccacacaccccgggctgatgtcccctcgctccggcggcctgcagaccccagagtgcctg
tctcgggagggctcccccattccacacgaccctgagtttgggtccaagttagcttctgtc
ccagagtaccggtattcccaaagcgcacccggctcccccgtcagcgcccagccagtgatc
atggccgtgcctccccgaccgtccagcctcgtggccaagcccgtggcctacatgcccgcc
tccatcgtaacctcacagcagcccgcgggccacgccatccacgtcgtgcagcaggccccc
accgtcaccatggtcagggtggtcaccacatctgccaactcggccaacggatacatcctc
accagccagggcgcggcggggggctcccatgatgcggcgggcgcagccgtgctggacctg
ggcagcgaggccagaggcctggaggagaaacccaccattgcgtttgccacaatccccgcg
gctggtggagtcatccagacggtggccagccagatggcccccggggtccccggacacacg
gtcaccatcctgcagcccgccacacccgtgaccctcgggcagcaccaccttccagtccgg
gccgtgacccagaacggaaagcatgcggttcccacgaacagtttagccggcaacgcttac
gccctcaccagccctttgcagctccttgcgacccaagcgagttcatccgcgccggtggtg
gtcacccgggtgtgcgaggtggggcccaaggagccagcagcagccgtcgcggccacggcc
accaccaccccagccactgccaccaccgcctctgcctccgcctcttccactggagagccc
gaggtcaaaaggtcccgggtggaggagcccagtggggctgtaaccacaccggctggagtg
atcgcagctgccggcccccaggggccaggcaccggggagtga

DBGET integrated database retrieval system