KEGG   Homo sapiens (human): 221955
Entry
221955            CDS       T01001                                 

Gene name
DAGLB, DAGLBETA, KCCR13L
Definition
(RefSeq) diacylglycerol lipase beta
  KO
K13806  sn1-specific diacylglycerol lipase [EC:3.1.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    221955 (DAGLB)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    221955 (DAGLB)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     221955 (DAGLB)
SSDB
Motif
Pfam: Lipase_3 Esterase Abhydrolase_6 Hydrolase_4 Abhydrolase_3
Other DBs
NCBI-GeneID: 221955
NCBI-ProteinID: NP_631918
OMIM: 614016
HGNC: 28923
Ensembl: ENSG00000164535
Vega: OTTHUMG00000125513
Pharos: Q8NCG7(Tchem)
UniProt: Q8NCG7
Position
7p22.1
AA seq 672 aa
MPGMVLFGRRWAIASDDLVFPGFFELVVRVLWWIGILTLYLMHRGKLDCAGGALLSSYLI
VLMILLAVVICTVSAIMCVSMRGTICNPGPRKSMSKLLYIRLALFFPEMVWASLGAAWVA
DGVQCDRTVVNGIIATVVVSWIIIAATVVSIIIVFDPLGGKMAPYSSAGPSHLDSHDSSQ
LLNGLKTAATSVWETRIKLLCCCIGKDDHTRVAFSSTAELFSTYFSDTDLVPSDIAAGLA
LLHQQQDNIRNNQEPAQVVCHAPGSSQEADLDAELENCHHYMQFAAAAYGWPLYIYRNPL
TGLCRIGGDCCRSRTTDYDLVGGDQLNCHFGSILHTTGLQYRDFIHVSFHDKVYELPFLV
ALDHRKESVVVAVRGTMSLQDVLTDLSAESEVLDVECEVQDRLAHKGISQAARYVYQRLI
NDGILSQAFSIAPEYRLVIVGHSLGGGAAALLATMLRAAYPQVRCYAFSPPRGLWSKALQ
EYSQSFIVSLVLGKDVIPRLSVTNLEDLKRRILRVVAHCNKPKYKILLHGLWYELFGGNP
NNLPTELDGGDQEVLTQPLLGEQSLLTRWSPAYSFSSDSPLDSSPKYPPLYPPGRIIHLQ
EEGASGRFGCCSAAHYSAKWSHEAEFSKILIGPKMLTDHMPDILMRALDSVVSDRAACVS
CPAQGVSSVDVA
NT seq 2019 nt   +upstreamnt  +downstreamnt
atgccggggatggtactcttcggccggcgctgggccatcgccagcgacgacttggtcttc
ccagggttcttcgagctggtcgtgcgagtgctgtggtggattggcattctgacgttgtat
ctcatgcacagaggaaagctggactgtgctggtggagccttgctcagcagttacttgatc
gtcctcatgattctcctggcagttgtcatatgtactgtgtcagccatcatgtgtgtcagc
atgagaggaacgatttgtaaccctggaccgcggaagtctatgtctaagctgctttacatc
cgcctggcgctgttttttccagagatggtctgggcctctctgggggctgcctgggtggca
gatggtgttcagtgcgacaggacagttgtaaacggcatcatcgcaaccgtcgtggtcagt
tggatcatcatcgctgccacagtggtttccattatcattgtctttgaccctcttgggggg
aaaatggctccatattcctctgccggccccagccacctggatagtcatgattcaagccag
ttacttaatggcctcaagacagcagctacaagcgtgtgggaaaccagaatcaagctcttg
tgctgttgcattgggaaagacgaccatactcgggttgctttttcgagtacggcagagctt
ttctcaacctacttttcagacacagatctggtgcccagcgacattgcggcgggcctcgcc
ctgcttcatcagcaacaggacaatatcaggaacaaccaagagcctgcccaggtggtctgc
catgccccagggagctcccaggaagctgatctggatgcagaattagaaaactgccatcat
tacatgcagtttgcagcagcggcctatgggtggcccctctacatctacagaaaccccctc
acggggctgtgcaggattggtggtgactgctgcagaagcagaaccacagactatgacttg
gtcggaggcgatcagctcaactgtcacttcggctccatcctgcacaccacagggctgcag
tacagggacttcatccacgtcagcttccatgacaaggtttacgagctgccgtttttagtg
gctctggatcacaggaaagagtctgttgtggtcgctgtgagggggaccatgtctctgcag
gatgtccttacggacctgtcagcggagagtgaggtgctggacgtggagtgtgaggtgcag
gaccgcctggcacacaagggtatttctcaagctgccagatacgtttaccaacgactcatc
aacgacgggattttgagccaagccttcagcattgctcctgagtaccggctggtcatagtg
ggccacagcctcgggggcggggcggccgccctgctggccaccatgctcagagccgcctac
ccgcaggtcaggtgctacgccttctccccaccccgggggctgtggagcaaagctctgcag
gaatattctcagagcttcatcgtgtcactcgtcctggggaaggatgtgattcccaggctc
agtgtgaccaacttggaagatctgaagagaagaatcttgcgagtggtcgcgcactgcaat
aaacccaagtacaagatcttgctgcacggtttgtggtacgaactgtttggaggaaacccc
aacaacttgcccacggagctggacgggggcgaccaggaagtcctgacacagcctcttctg
ggggagcagagcctactgacgcgctggtccccggcctacagcttctccagcgactcccca
ctggactcttctcccaagtacccccctctctaccctcccggcaggatcatccacctgcag
gaggagggcgcctcggggcggtttggctgctgctctgctgctcactatagcgccaagtgg
tcacacgaagcggaattcagcaaaatactcataggtccgaagatgctcaccgaccacatg
ccagacatcctgatgcgggccttggacagcgtggtctccgacagagcggcctgcgtctcc
tgtccagcacaaggggtctccagtgtggacgtggcctga

DBGET integrated database retrieval system