KEGG   Homo sapiens (human): 221981Help
Entry
221981            CDS       T01001                                 

Gene name
THSD7A
Definition
(RefSeq) thrombospondin type 1 domain containing 7A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_1 Auts2
Motif
Other DBs
NCBI-GeneID: 221981
NCBI-ProteinID: NP_056019
OMIM: 612249
HGNC: 22207
Ensembl: ENSG00000005108
Vega: OTTHUMG00000152346
Pharos: Q9UPZ6(Tbio)
UniProt: Q9UPZ6
Position
7p21.3
AA seq 1657 aa AA seqDB search
MGLQARRWASGSRGAAGPRRGVLQLLPLPLPLPLLLLLLLRPGAGRAAAQGEAEAPTLYL
WKTGPWGRCMGDECGPGGIQTRAVWCAHVEGWTTLHTNCKQAERPNNQQNCFKVCDWHKE
LYDWRLGPWNQCQPVISKSLEKPLECIKGEEGIQVREIACIQKDKDIPAEDIICEYFEPK
PLLEQACLIPCQQDCIVSEFSAWSECSKTCGSGLQHRTRHVVAPPQFGGSGCPNLTEFQV
CQSSPCEAEELRYSLHVGPWSTCSMPHSRQVRQARRRGKNKEREKDRSKGVKDPEARELI
KKKRNRNRQNRQENKYWDIQIGYQTREVMCINKTGKAADLSFCQQEKLPMTFQSCVITKE
CQVSEWSEWSPCSKTCHDMVSPAGTRVRTRTIRQFPIGSEKECPEFEEKEPCLSQGDGVV
PCATYGWRTTEWTECRVDPLLSQQDKRRGNQTALCGGGIQTREVYCVQANENLLSQLSTH
KNKEASKPMDLKLCTGPIPNTTQLCHIPCPTECEVSPWSAWGPCTYENCNDQQGKKGFKL
RKRRITNEPTGGSGVTGNCPHLLEAIPCEEPACYDWKAVRLGNCEPDNGKECGPGTQVQE
VVCINSDGEEVDRQLCRDAIFPIPVACDAPCPKDCVLSTWSTWSSCSHTCSGKTTEGKQI
RARSILAYAGEEGGIRCPNSSALQEVRSCNEHPCTVYHWQTGPWGQCIEDTSVSSFNTTT
TWNGEASCSVGMQTRKVICVRVNVGQVGPKKCPESLRPETVRPCLLPCKKDCIVTPYSDW
TSCPSSCKEGDSSIRKQSRHRVIIQLPANGGRDCTDPLYEEKACEAPQACQSYRWKTHKW
RRCQLVPWSVQQDSPGAQEGCGPGRQARAITCRKQDGGQAGIHECLQYAGPVPALTQACQ
IPCQDDCQLTSWSKFSSCNGDCGAVRTRKRTLVGKSKKKEKCKNSHLYPLIETQYCPCDK
YNAQPVGNWSDCILPEGKVEVLLGMKVQGDIKECGQGYRYQAMACYDQNGRLVETSRCNS
HGYIEEACIIPCPSDCKLSEWSNWSRCSKSCGSGVKVRSKWLREKPYNGGRPCPKLDHVN
QAQVYEVVPCHSDCNQYLWVTEPWSICKVTFVNMRENCGEGVQTRKVRCMQNTADGPSEH
VEDYLCDPEEMPLGSRVCKLPCPEDCVISEWGPWTQCVLPCNQSSFRQRSADPIRQPADE
GRSCPNAVEKEPCNLNKNCYHYDYNVTDWSTCQLSEKAVCGNGIKTRMLDCVRSDGKSVD
LKYCEALGLEKNWQMNTSCMVECPVNCQLSDWSPWSECSQTCGLTGKMIRRRTVTQPFQG
DGRPCPSLMDQSKPCPVKPCYRWQYGQWSPCQVQEAQCGEGTRTRNISCVVSDGSADDFS
KVVDEEFCADIELIIDGNKNMVLEESCSQPCPGDCYLKDWSSWSLCQLTCVNGEDLGFGG
IQVRSRPVIIQELENQHLCPEQMLETKSCYDGQCYEYKWMASAWKGSSRTVWCQRSDGIN
VTGGCLVMSQPDADRSCNPPCSQPHSYCSETKTCHCEEGYTEVMSSNSTLEQCTLIPVVV
LPTMEDKRGDVKTSRAVHPTQPSSNPAGRGRTWFLQPFGPDGRLKTWVYGVAAGAFVLLI
FIVSMIYLACKKPKKPQRRQNNRLKPLTLAYDGDADM
NT seq 4974 nt NT seq  +upstreamnt  +downstreamnt
atggggctgcaagccaggcgctgggcgtccgggagccggggcgctgcggggccgcgccgg
ggcgtcctgcagctgctgccgctgccgctgccgctgccgctgctcctgctgctgctgcta
cgcccgggcgccggcagggctgcggcgcagggcgaggcggaggcgcccaccctctatctg
tggaagactggtccatggggccgatgtatgggagatgaatgtggtcccggaggcatccaa
acgagggctgtgtggtgtgctcatgtggagggatggactacactgcatactaactgtaag
caggccgagagacccaataaccagcagaattgtttcaaagtttgcgattggcacaaagag
ttgtacgactggagactgggaccttggaatcagtgtcagcccgtgatttcaaaaagccta
gagaaacctcttgagtgcattaagggggaagaaggtattcaggtgagggagatagcgtgc
atccagaaagacaaagacattcctgcggaggatatcatctgtgagtactttgagcccaag
cctctcctggagcaggcttgcctcattccttgccagcaagattgcatcgtgtctgaattt
tctgcctggtccgaatgctccaagacctgcggcagcgggctccagcaccggacgcgtcat
gtggtggcgcccccgcagttcggaggctctggctgtccaaacctgacggagttccaggtg
tgccaatccagtccatgcgaggccgaggagctcaggtacagcctgcatgtggggccctgg
agcacctgctcaatgccccactcccgacaagtaagacaagcaaggagacgcgggaagaat
aaagaacgggaaaaggaccgcagcaaaggagtaaaggatccagaagcccgcgagcttatt
aagaaaaagagaaacagaaacaggcagaacagacaagagaacaaatattgggacatccag
attggatatcagaccagagaggttatgtgcattaacaagacggggaaagctgctgattta
agcttttgccagcaagagaagcttccaatgaccttccagtcctgtgtgatcaccaaagag
tgccaggtttccgagtggtcagagtggagcccctgctcaaaaacatgccatgacatggtg
tcccctgcaggcactcgtgtaaggacacgaaccatcaggcagtttcccattggcagtgaa
aaggagtgtccagaatttgaagaaaaagaaccctgtttgtctcaaggagatggagttgtc
ccctgtgccacgtatggctggagaactacagagtggactgagtgccgtgtggaccctttg
ctcagtcagcaggacaagaggcgcggcaaccagacggccctctgtggagggggcatccag
acccgagaggtgtactgcgtgcaggccaacgaaaacctcctctcacaattaagtacccac
aagaacaaagaagcctcaaagccaatggacttaaaattatgcactggacctatccctaat
actacacagctgtgccacattccttgtccaactgaatgtgaagtttcaccttggtcagct
tggggaccttgtacttatgaaaactgtaatgatcagcaagggaaaaaaggcttcaaactg
aggaagcggcgcattaccaatgagcccactggaggctctggggtaaccggaaactgccct
cacttactggaagccattccctgtgaagagcctgcctgttatgactggaaagcagtgaga
ctgggaaactgcgagccagataacggaaaggagtgtggtccaggcacgcaagttcaagag
gttgtgtgcatcaacagtgatggagaagaagttgacagacagctgtgcagagatgccatc
ttccccatccctgtggcctgtgatgccccatgcccgaaagactgtgtgctcagcacatgg
tctacgtggtcctcctgctcacacacctgctcagggaaaacgacagaagggaaacagata
cgagcacgatccattctggcctatgcgggtgaagaaggtggaattcgctgtccaaatagc
agtgctttgcaagaagtacgaagctgtaatgagcatccttgcacagtgtaccactggcaa
actggtccctggggccagtgcattgaggacacctcagtatcgtccttcaacacaactacg
acttggaatggggaggcctcctgctctgtcggcatgcagacaagaaaagtcatctgtgtg
cgagtcaatgtgggccaagtgggacccaaaaaatgtcctgaaagccttcgacctgaaact
gtaaggccttgtctgcttccttgtaagaaggactgtattgtgaccccatatagtgactgg
acatcatgcccctcttcgtgtaaagaaggggactccagtatcaggaagcagtctaggcat
cgggtcatcattcagctgccagccaacgggggccgagactgcacagatcccctctatgaa
gagaaggcctgtgaggcacctcaagcgtgccaaagctacaggtggaagactcacaaatgg
cgcagatgccaattagtcccttggagcgtgcaacaagacagccctggagcacaggaaggc
tgtgggcctgggcgacaggcaagagccattacttgtcgcaagcaagatggaggacaggct
ggaatccatgagtgcctacagtatgcaggccctgtgccagcccttacccaggcctgccag
atcccctgccaggatgactgtcaattgaccagctggtccaagttttcttcatgcaatgga
gactgtggtgcagttaggaccagaaagcgcactcttgttggaaaaagtaaaaagaaggaa
aaatgtaaaaattcccatttgtatcccctgattgagactcagtattgtccttgtgacaaa
tataatgcacaacctgtggggaactggtcagactgtattttaccagagggaaaagtggaa
gtgttgctgggaatgaaagtacaaggagacatcaaggaatgcggacaaggatatcgttac
caagcaatggcatgctacgatcaaaatggcaggcttgtggaaacatctagatgtaacagc
catggttacattgaggaggcctgcatcatcccctgcccctcagactgcaagctcagtgag
tggtccaactggtcgcgctgcagcaagtcctgtgggagtggtgtgaaggttcgttctaaa
tggctgcgtgaaaaaccatataatggaggaaggccttgccccaaactggaccatgtcaac
caggcacaggtgtatgaggttgtcccatgccacagtgactgcaaccagtacctatgggtc
acagagccctggagcatctgcaaggtgacctttgtgaatatgcgggagaactgtggagag
ggcgtgcaaacccgaaaagtgagatgcatgcagaatacagcagatggcccttctgaacat
gtagaggattacctctgtgacccagaagagatgcccctgggctctagagtgtgcaaatta
ccatgccctgaggactgtgtgatatctgaatggggtccatggacccaatgtgttttgcct
tgcaatcaaagcagtttccggcaaaggtcagctgatcccatcagacaaccagctgatgaa
ggaagatcttgccctaatgctgttgagaaagaaccctgtaacctgaacaaaaactgctac
cactatgattataatgtaacagactggagtacatgtcagctgagtgagaaggcagtttgt
ggaaatggaataaaaacaaggatgttggattgtgttcgaagtgatggcaagtcagttgac
ctgaaatattgtgaagcgcttggcttggagaagaactggcagatgaacacgtcctgcatg
gtggaatgccctgtgaactgtcagctttctgattggtctccttggtcagaatgttctcaa
acatgtggcctcacaggaaaaatgatccgaagacgaacagtgacccagccctttcaaggt
gatggaagaccatgcccttccctgatggaccagtccaaaccctgcccagtgaagccttgt
tatcggtggcaatatggccagtggtctccatgccaagtgcaggaggcccagtgtggagaa
gggaccagaacaaggaacatttcttgtgtagtaagtgatgggtcagctgatgatttcagc
aaagtggtggatgaggaattctgtgctgacattgaactcattatagatggtaataaaaat
atggttctggaggaatcctgcagccagccttgcccaggtgactgttatttgaaggactgg
tcttcctggagcctgtgtcagctgacctgtgtgaatggtgaggatctaggctttggtgga
atacaggtcagatccagaccggtgattatacaagaactagagaatcagcatctgtgccca
gagcagatgttagaaacaaaatcatgttatgatggacagtgctatgaatataaatggatg
gccagtgcttggaagggctcttcccgaacagtgtggtgtcaaaggtcagatggtataaat
gtaacagggggctgcttggtgatgagccagcctgatgccgacaggtcttgtaacccaccg
tgtagtcaaccccactcgtactgtagcgagacaaaaacatgccattgtgaagaagggtac
actgaagtcatgtcttctaacagcacccttgagcaatgcacacttatccccgtggtggta
ttacccaccatggaggacaaaagaggagatgtgaaaaccagtcgggctgtacatccaacc
caaccctccagtaacccagcaggacggggaaggacctggtttctacagccatttgggcca
gatgggagactaaagacctgggtttacggtgtagcagctggggcatttgtgttactcatc
tttattgtctccatgatttatctagcttgcaaaaagccaaagaaaccccaaagaaggcaa
aacaaccgactgaaacctttaaccttagcctatgatggagatgccgacatgtaa

DBGET integrated database retrieval system