KEGG   Homo sapiens (human): 222255Help
Entry
222255            CDS       T01001                                 

Gene name
ATXN7L1, ATXN7L4
Definition
(RefSeq) ataxin 7 like 1
  KO
K11318  ataxin-7
Organism
hsa  Homo sapiens (human)
Brite
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     222255 (ATXN7L1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TFTC complex
     222255 (ATXN7L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SCA7 OrsD
Motif
Other DBs
NCBI-GeneID: 222255
NCBI-ProteinID: NP_065776
HGNC: 22210
Ensembl: ENSG00000146776
Vega: OTTHUMG00000157521
Pharos: Q9ULK2(Tdark)
UniProt: Q9ULK2
Position
7q22.3
AA seq 861 aa AA seqDB search
MTSERSRIPCLSAAAAEGTGKKQQEGRAMATLDRKVPSPEAFLGKPWSSWIDAAKLHCSD
NVDLEEAGKEGGKSREVMRLNKEDMHLFGHYPAHDDFYLVVCSACNQVVKPQVFQSHCER
RHGSMCRPSPSPVSPASNPRTSLVQVKTKACLSGHHSASSTSKPFKTPKDNLLTSSSKQH
TVFPAKGSRDKPCVPVPVVSLEKIPNLVKADGANVKMNSTTTTAVSASSTSSSAVSTPPL
IKPVLMSKSVPPSPEKILNGKGILPTTIDKKHQNGTKNSNKPYRRLSEREFDPNKHCGVL
DPETKKPCTRSLTCKTHSLSHRRAVPGRKKQFDLLLAEHKAKSREKEVKDKEHLLTSTRE
ILPSQSGPAQDSLLGSSGSSGPEPKVASPAKSRPPNSVLPRPSSANSISSSTSSNHSGHT
PEPPLPPVGGDLASRLSSDEGEMDGADESEKLDCQFSTHHPRPLAFCSFGSRLMGRGYYV
FDRRWDRFRFALNSMVEKHLNSQMWKKIPPAADSPLPSPAAHITTPVPASVLQPFSNPSA
VYLPSAPISSRLTSSYIMTSAMLSNAAFVTSPDPSALMSHTTAFPHVAATLSIMDSTFKA
PSAVSPIPAVIPSPSHKPSKTKTSKSSKVKDLSTRSDESPSNKKRKPQSSTSSSSSSSSS
SLQTSLSSPLSGPHKKNCVLNASSALNSYQAAPPYNSLSVHNSNNGVSPLSAKLEPSGRT
SLPGGPADIVRQVGAVGGSSDSCPLSVPSLALHAGDLSLASHNAVSSLPLSFDKSEGKKR
KNSSSSSKACKITKMPGMNSVHKKNPPSLLAPVPDPVNSTSSRQVGKNSSLALSQSSPSS
ISSPGHSRQNTNRTGRIRTLP
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcggagcgttctcgaatcccgtgtctctcggctgctgctgccgaaggaacaggg
aaaaagcaacaagaaggaagagcaatggcgacactggatcgcaaagtgcccagtccggag
gcgtttctgggcaaaccctggtcctcctggatcgacgccgccaaattacactgctccgac
aatgtagatttagaagaggctggaaaagagggtggaaaaagcagggaggttatgaggctt
aataaagaagatatgcacttatttggccattacccagcacatgacgacttctatctcgta
gtgtgcagtgcctgtaaccaggtcgtcaagccacaggttttccagtcgcactgcgagaga
agacacggttcaatgtgtagaccttctccctctccagtgtctccagcctccaatcccagg
acatcactagtacaggtgaaaacaaaagcctgtctcagcggccatcactctgccagcagc
acctcaaagccattcaaaacgcccaaagacaatctacttacctccagcagcaaacagcac
acagtctttcctgcgaaaggatcaagggataaaccatgtgttccagttcctgtagtcagt
ttagagaaaattcctaacctagtgaaggcagatggtgccaatgtcaaaatgaactccaca
accactactgcagtttctgcctcctccacctcgtcctctgccgtctccacccctccttta
attaagcctgtcctgatgtccaagtcagtgccaccttcaccagagaagatcttaaatggc
aaaggaattctgccaaccaccatagacaagaaacaccaaaatggcaccaaaaacagcaac
aagccttacaggagactttcagagagagaatttgacccaaataaacactgtggagtattg
gatcccgagacaaagaaaccttgcacaagatccctcacctgcaagacacattcgctaagc
catcggagggcagtcccaggccggaaaaagcaatttgacctcctcctggcagaacacaaa
gcaaagtcccgggaaaaagaagttaaagataaagagcatctcctgacttccacgagggaa
atacttccaagccaatccgggccggcacaggattctctgctagggtcttcagggagctct
gggccagaaccaaaagttgcatcccctgcaaaatccagaccacccaactctgtacttcct
agaccatcatctgcaaatagcataagcagcagcacatcttcaaatcatagcggccacact
ccagagcccccactcccaccggttggaggtgacctcgccagccgactgtccagtgatgaa
ggggagatggacggagccgacgaatccgagaagctagactgtcagttctccacgcaccac
cccagacctctggcgttttgctcatttgggagtcgcctcatgggacgagggtactatgtg
tttgatagaagatgggatcgttttcgattcgcactaaactccatggtagaaaaacacctg
aattcacagatgtggaagaagatccctcctgcggcagatagccccctgccctcgccagca
gcccacatcaccacccccgttccagcatccgttttgcagcctttcagcaaccccagtgct
gtgtatcttccttcagctcccatcagctcgaggctcacctcttcttacataatgacatca
gccatgctctcaaacgcagctttcgtgacatcgccggacccgagcgccctcatgtcccac
accacagctttccctcatgtggccgcaaccctcagcatcatggactcaaccttcaaggcc
ccatccgccgtgtccccgataccagccgtcatcccttccccatcccacaagccatccaaa
accaaaaccagcaaatcctcaaaagtcaaagacctgtccacccgtagcgacgagtctcca
agtaacaaaaaaaggaagccacagtcttcgacttcctcctcctcctcctcctcctcctct
tccttgcagacatccctctcgtctccactgtcagggcctcacaaaaagaactgtgttttg
aatgccagttctgctttgaactcctatcaggcggcccctccctataacagcctgtctgtg
cacaactcaaacaatggggtgagcccactcagtgccaaactggagccctcaggacggacc
tcgctgcccggcggccccgcggacatagtgagacaggtgggcgcggtgggaggcagcagt
gactcctgtcccctctctgtgccctcccttgcgctccacgcaggggacctctctctggcc
tcacacaatgctgtgtcttctctgcccctctcttttgacaaatcagaaggaaaaaagcgt
aagaactcgagttctagtagcaaagcctgtaaaatcactaaaatgcctggtatgaatagc
gttcacaaaaagaacccgcccagccttctcgcaccggtgcccgatcccgttaacagcacc
tcctctcggcaggttgggaaaaatagcagcctagctttgtcacaatccagtccttcaagt
atatccagcccaggacacagccgacagaacacaaacagaacgggcaggataaggactctt
ccataa

DBGET integrated database retrieval system