KEGG   Homo sapiens (human): 222389
Entry
222389            CDS       T01001                                 

Gene name
BEND7, C10orf30
Definition
(RefSeq) BEN domain containing 7
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: BEN
Other DBs
NCBI-GeneID: 222389
NCBI-ProteinID: NP_689964
HGNC: 23514
Ensembl: ENSG00000165626
Vega: OTTHUMG00000017699
Pharos: Q8N7W2(Tdark)
UniProt: Q8N7W2
Position
10p13
AA seq 468 aa
MEIKKQITGMRRLLNDSTGRIYQRVGKEGEKLKEEPQDLDLVWPPRLNSSAEAPQSLHPS
SRGVWNELPPQSGQFSGQYGTRSRTFQSQPHPTTSSNGELPVVNSSAGSNCCTCNCQSTL
QAILQELKTMRKLMQIQAVGTQNRQQPPISLICSQRTAVSRKRNKKKKVPPKTVEPLTVK
QKPSGSEMEKKSVVASELSALQAAEHTSPEESRVLGFGIVLESPSSDPEVQLAEGFDVFM
PKSQLDSILSNYTRSGSLLFRKLVCAFFDDKTLANSLPNGKRKRGLNDNRKGLDQNIVGA
IKVFTEKYCTANHVDKLPGPRDWVQILQDQIKLARRRLKRGSAEIADSDERLDGIALPPT
GACGGPCTVLPGGSAAVTLVLQSSPQTMSQEKGQMAEPWEEQHLVLLNNLTRDRAETGAL
SQTSQDFKHHSFLITQVSATLHHQRGIRNFPTPGSAKSLTLHISCLSL
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggaaataaaaaagcaaattacagggatgagaagattgctgaacgacagcactgggcgg
atctatcagcgagttggcaaagaaggagagaaactaaaagaagagccccaggacctggat
ttagtctggcctccacgtttgaactcctctgctgaggccccgcaaagcctccacccgtct
tcacgtggtgtgtggaatgagctaccgccccagagtggacagttctcagggcagtatggc
acccgttctagaaccttccaaagccagccccaccctaccacgagctccaatggagaactt
ccagtggtgaattcatcagctggatcaaactgctgtacttgtaactgccagtcaacgttg
caggccattctacaagaactcaagaccatgaggaaattaatgcaaattcaagcagttgga
actcaaaacagacaacaacctccaatttcccttatatgctcccagcgaactgctgtctca
cgaaagagaaataaaaagaaaaaagtgcccccaaagactgtggaacctcttactgtgaaa
cagaagcccagtgggtcagagatggagaaaaagtcggtggtggcctctgagctatctgct
ctccaggcagccgagcacacctccccggaggagagccgcgttctaggattcggcattgtt
ctggaatcaccttcctcagatccagaagtacaacttgctgaaggctttgacgtgtttatg
cctaaatctcagctggactctatattgtcaaactacactcgctcaggaagccttctgttt
agaaaactggtgtgtgcgttttttgatgacaagactttggctaactccttacccaatggg
aagaggaaaagaggactcaatgacaaccggaaaggactagaccaaaatattgtgggtgca
ataaaagtcttcacagaaaagtactgtacagctaaccatgtggataagcttcctggccca
agagattgggtacagattctacaggatcaaattaaactggccagaagaaggttaaaaaga
ggctcagcagagatcgcggacagtgatgaaagactggacggcattgctctaccaccaaca
ggtgcttgtggtgggccctgcactgttctgccgggtgggagtgcagcggtgaccctagtc
ttgcagagctcacctcagacaatgtcacaagaaaagggacagatggcagaaccctgggag
gagcagcatctcgtgctcctgaacaaccttaccagagacagagctgaaacaggagctttg
tcccaaaccagccaagacttcaagcaccattcattcctcataactcaggtctcagctaca
cttcatcatcagagagggattcgcaactttcccacgccaggctcagccaagtctcttacc
cttcacatctcttgcctctctctctga

DBGET integrated database retrieval system