KEGG   Homo sapiens (human): 222487Help
Entry
222487            CDS       T01001                                 

Gene name
ADGRG3, GPR97, PB99, PGR26
Definition
(RefSeq) adhesion G protein-coupled receptor G3
  KO
K08452  adhesion G-protein coupled receptor G3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    222487 (ADGRG3)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    222487 (ADGRG3)
Peptidases and inhibitors [BR:hsa01002]
 Mixed peptidases
  Family P2
   222487 (ADGRG3)
G protein-coupled receptors [BR:hsa04030]
 Adhesion receptor family
  Others
   222487 (ADGRG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 GPS
Motif
Other DBs
NCBI-GeneID: 222487
NCBI-ProteinID: NP_740746
OMIM: 618441
HGNC: 13728
Ensembl: ENSG00000182885
Vega: OTTHUMG00000133458
Pharos: Q86Y34(Tchem)
UniProt: Q86Y34
Position
16q21
AA seq 549 aa AA seqDB search
MATPRGLGALLLLLLLPTSGQEKPTEGPRNTCLGSNNMYDIFNLNDKALCFTKCRQSGSD
SCNVENLQRYWLNYEAHLMKEGLTQKVNTPFLKALVQNLSTNTAEDFYFSLEPSQVPRQV
MKDEDKPPDRVRLPKSLFRSLPGNRSVVRLAVTILDIGPGTLFKGPRLGLGDGSGVLNNR
LVGLSVGQMHVTKLAEPLEIVFSHQRPPPNMTLTCVFWDVTKGTTGDWSSEGCSTEVRPE
GTVCCCDHLTFFALLLRPTLDQSTVHILTRISQAGCGVSMIFLAFTIILYAFLRLSRERF
KSEDAPKIHVALGGSLFLLNLAFLVNVGSGSKGSDAACWARGAVFHYFLLCAFTWMGLEA
FHLYLLAVRVFNTYFGHYFLKLSLVGWGLPALMVIGTGSANSYGLYTIRDRENRTSLELC
WFREGTTMYALYITVHGYFLITFLFGMVVLALVVWKIFTLSRATAVKERGKNRKKVLTLL
GLSSLVGVTWGLAIFTPLGLSTVYIFALFNSLQGVFICCWFTILYLPSQSTTVSSSTARL
DQAHSASQE
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgcccaggggcctgggggccctgctcctgctcctcctgctcccgacctcaggt
caggaaaagcccaccgaagggccaagaaacacctgcctggggagcaacaacatgtacgac
atcttcaacttgaatgacaaggctttgtgcttcaccaagtgcaggcagtcgggcagcgac
tcctgcaatgtggaaaacttgcagagatactggctaaactacgaggcccatctgatgaag
gaaggtttgacgcagaaggtgaacacgcctttcctgaaggctttggtccagaacctcagc
accaacactgcagaagacttctatttctctctggagccctctcaggttccgaggcaggtg
atgaaggacgaggacaagccccctgacagagtgcgacttcccaagagcctttttcgatcc
ctgccaggcaacaggtctgtggtccgcttggccgtcaccattctggacattggtccaggg
actctcttcaagggcccccggctcggcctgggagatggcagcggcgtgttgaacaatcgc
ctggtgggtttgagtgtgggacaaatgcatgtcaccaagctggctgagcctctggagatc
gtcttctctcaccagcgaccgccccctaacatgaccctcacctgtgtattctgggatgtg
actaaagggaccactggagactggtcttctgagggctgctccacggaggtcagacctgag
gggaccgtgtgctgctgtgaccacctgacctttttcgccctgctcctgagacccaccttg
gaccagtccacggtgcatatcctcacacgcatctcccaggcgggctgtggggtctccatg
atcttcctggccttcaccattattctttatgcctttctgaggctttcccgggagaggttc
aagtcagaagatgccccaaagatccacgtggccctgggtggcagcctgttcctcctgaat
ctggccttcttggtcaatgtggggagtggctcaaaggggtctgatgctgcctgctgggcc
cggggggctgtcttccactacttcctgctctgtgccttcacctggatgggccttgaagcc
ttccacctctacctgctcgctgtcagggtcttcaacacctacttcgggcactacttcctg
aagctgagcctggtgggctggggcctgcccgccctgatggtcatcggcactgggagtgcc
aacagctacggcctctacaccatccgtgatagggagaaccgcacctctctggagctatgc
tggttccgtgaagggacaaccatgtacgccctctatatcaccgtccacggctacttcctc
atcaccttcctctttggcatggtggtcctggccctggtggtctggaagatcttcaccctg
tcccgtgctacagcggtcaaggagcgggggaagaaccggaagaaggtgctcaccctgctg
ggcctctcgagcctggtgggtgtgacatgggggttggccatcttcaccccgttgggcctc
tccaccgtctacatctttgcacttttcaactccttgcaaggtgtcttcatctgctgctgg
ttcaccatcctttacctcccaagtcagagcaccacagtctcctcctctactgcaagattg
gaccaggcccactccgcatctcaagaatag

DBGET integrated database retrieval system