KEGG   Homo sapiens (human): 222545Help
Entry
222545            CDS       T01001                                 

Gene name
GPRC6A, GPCR, bA86F4.3
Definition
(RefSeq) G protein-coupled receptor class C group 6 member A
  KO
K04622  G protein-coupled receptor family C group 6 member A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    222545 (GPRC6A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    222545 (GPRC6A)
G protein-coupled receptors [BR:hsa04030]
 Metabotropic glutamate receptor family
  Calcium-sensing
   222545 (GPRC6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 222545
NCBI-ProteinID: NP_683766
OMIM: 613572
HGNC: 18510
Ensembl: ENSG00000173612
Vega: OTTHUMG00000015447
Pharos: Q5T6X5(Tbio)
UniProt: Q5T6X5
Position
6q22.1
AA seq 926 aa AA seqDB search
MAFLIILITCFVIILATSQPCQTPDDFVAATSPGHIIIGGLFAIHEKMLSSEDSPRRPQI
QECVGFEISVFLQTLAMIHSIEMINNSTLLPGVKLGYEIYDTCTEVTVAMAATLRFLSKF
NCSRETVEFKCDYSSYMPRVKAVIGSGYSEITMAVSRMLNLQLMPQVGYESTAEILSDKI
RFPSFLRTVPSDFHQIKAMAHLIQKSGWNWIGIITTDDDYGRLALNTFIIQAEANNVCIA
FKEVLPAFLSDNTIEVRINRTLKKIILEAQVNVIVVFLRQFHVFDLFNKAIEMNINKMWI
ASDNWSTATKITTIPNVKKIGKVVGFAFRRGNISSFHSFLQNLHLLPSDSHKLLHEYAMH
LSACAYVKDTDLSQCIFNHSQRTLAYKANKAIERNFVMRNDFLWDYAEPGLIHSIQLAVF
ALGYAIRDLCQARDCQNPNAFQPWELLGVLKNVTFTDGWNSFHFDAHGDLNTGYDVVLWK
EINGHMTVTKMAEYDLQNDVFIIPDQETKNEFRNLKQIQSKCSKECSPGQMKKTTRSQHI
CCYECQNCPENHYTNQTDMPHCLLCNNKTHWAPVRSTMCFEKEVEYLNWNDSLAILLLIL
SLLGIIFVLVVGIIFTRNLNTPVVKSSGGLRVCYVILLCHFLNFASTSFFIGEPQDFTCK
TRQTMFGVSFTLCISCILTKSLKILLAFSFDPKLQKFLKCLYRPILIIFTCTGIQVVICT
LWLIFAAPTVEVNVSLPRVIILECEEGSILAFGTMLGYIAILAFICFIFAFKGKYENYNE
AKFITFGMLIYFIAWITFIPIYATTFGKYVPAVEIIVILISNYGILYCTFIPKCYVIICK
QEINTKSAFLKMIYSYSSHSVSSIALSPASLDSMSGNVTMTNPSSSGKSATWQKSKDLQA
QAFAHICRENATSVSKTLPRKRMSSI
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atggcattcttaattatactaattacctgctttgtgattattcttgctacttcacagcct
tgccagacccctgatgactttgtggctgccacttctccgggacatatcataattggaggt
ttgtttgctattcatgaaaaaatgttgtcctcagaagactctcccagacgaccacaaatc
caggagtgtgttggctttgaaatatcagtttttcttcaaactcttgccatgatacacagc
attgagatgatcaacaattcaacactcttacctggagtcaaactggggtatgaaatctat
gacacttgtacagaagtcacagtggcaatggcagccactctgaggtttctttctaaattc
aactgctccagagaaactgtggagtttaagtgtgactattccagctacatgccaagagtt
aaggctgtcataggttctgggtactcagaaataactatggctgtctccaggatgttgaat
ttacagctcatgccacaggtgggttatgaatcaactgcagaaatcctgagtgacaaaatt
cgctttccttcatttttacggactgtgcccagtgacttccatcaaattaaagcaatggct
cacctgattcagaaatctggttggaactggattggcatcataaccacagatgatgactat
ggacgattggctcttaacacttttataattcaggctgaagcaaataacgtgtgcatagcc
ttcaaagaggttcttccagcctttctttcagataataccattgaagtcagaatcaatcgg
acactgaagaaaatcattttagaagcccaggttaatgtcattgtggtatttctgaggcaa
ttccatgtttttgatctcttcaataaagccattgaaatgaatataaataagatgtggatt
gctagtgataattggtcaactgccaccaagattaccaccattcctaatgttaaaaagatt
ggcaaagttgtagggtttgcctttagaagagggaatatatcctctttccattcctttctt
caaaatctgcacttgcttcccagtgacagtcacaaactcttacatgaatatgccatgcat
ttatctgcctgcgcatatgtcaaggacactgatttgagtcaatgcatattcaatcattct
caaaggactttggcctacaaggctaacaaggctatagaaaggaacttcgtcatgagaaat
gacttcctctgggactatgctgagccaggactcattcatagtattcagcttgcagtgttt
gcccttggttatgccattcgggatctgtgtcaagctcgtgactgtcagaaccccaacgcc
tttcaaccatgggagttacttggtgtgctaaaaaatgtgacattcactgatggatggaat
tcatttcattttgatgctcacggggatttaaatactggatatgatgttgtgctctggaag
gagatcaatggacacatgactgtcactaagatggcagaatatgacctacagaatgatgtc
ttcatcatcccagatcaggaaacaaaaaatgagttcaggaatcttaagcaaattcaatct
aaatgctccaaggaatgcagtcctgggcaaatgaagaaaactacaagaagtcaacacatc
tgttgctatgaatgtcagaactgtcctgaaaatcattacactaatcagacagatatgcct
cactgccttttatgcaacaacaaaactcactgggcccctgttaggagcactatgtgcttt
gaaaaggaagtggaatatctcaactggaatgactccttggccatcctactcctgattctc
tccctactgggaatcatatttgttctggttgttggcataatatttacaagaaacctgaac
acacctgttgtgaaatcatccgggggattaagagtctgctatgtgatccttctctgtcat
ttcctcaattttgccagcacgagctttttcattggagaaccacaagacttcacatgtaaa
accaggcagacaatgtttggagtgagctttactctttgcatctcctgcattttgacgaag
tctctgaaaattttgctagccttcagctttgatcccaaattacagaaatttctgaagtgc
ctctatagaccgatccttattatcttcacttgcacgggcatccaggttgtcatttgcaca
ctctggctaatctttgcagcacctactgtagaggtgaatgtctccttgcccagagtcatc
atcctggagtgtgaggagggatccatacttgcatttggcaccatgctgggctacattgcc
atcctggccttcatttgcttcatatttgctttcaaaggcaaatatgagaattacaatgaa
gccaaattcattacatttggcatgctcatttacttcatagcttggatcacattcatccct
atctatgctaccacatttggcaaatatgtaccagctgtggagattattgtcatattaata
tctaactatggaatcctgtattgcacattcatccccaaatgctatgttattatttgtaag
caagagattaacacaaagtctgcctttctcaagatgatctacagttattcttcccatagt
gtgagcagcattgccctgagtcctgcttcactggactccatgagcggcaatgtcacaatg
accaatcccagctctagtggcaagtctgcaacctggcagaaaagcaaagatcttcaggca
caagcatttgcacacatatgcagggaaaatgccacaagtgtatctaaaactttgcctcga
aaaagaatgtcaagtatatga

DBGET integrated database retrieval system