KEGG   Homo sapiens (human): 222663
Entry
222663            CDS       T01001                                 

Gene name
SCUBE3, CEGF3, SSFSC2
Definition
(RefSeq) signal peptide, CUB domain and EGF like domain containing 3
  KO
K24468  signal peptide, CUB and EGF-like domain-containing protein 1/3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    222663 (SCUBE3)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EGF-like domain-containing proteins
  hEGF / cEGF domain-containing proteins
   222663 (SCUBE3)
SSDB
Motif
Pfam: FXa_inhibition cEGF Ephrin_rec_like EGF_CA EGF_3 CUB EGF hEGF Plasmod_Pvs28
Other DBs
NCBI-GeneID: 222663
NCBI-ProteinID: NP_689966
OMIM: 614708
HGNC: 13655
Ensembl: ENSG00000146197
Vega: OTTHUMG00000014562
Pharos: Q8IX30(Tbio)
UniProt: Q8IX30
Position
6p21.31
AA seq 993 aa
MGSGRVPGLCLLVLLVHARAAQYSKAAQDVDECVEGTDNCHIDAICQNTPRSYKCICKSG
YTGDGKHCKDVDECEREDNAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAEGN
GGCQQSCVNMMGSYECHCREGFFLSDNQHTCIQRPEEGMNCMNKNHGCAHICRETPKGGI
ACECRPGFELTKNQRDCKLTCNYGNGGCQHTCDDTEQGPRCGCHIKFVLHTDGKTCIETC
AVNNGGCDSKCHDAATGVHCTCPVGFMLQPDRKTCKDIDECRLNNGGCDHICRNTVGSFE
CSCKKGYKLLINERNCQDIDECSFDRTCDHICVNTPGSFQCLCHRGYLLYGITHCGDVDE
CSINRGGCRFGCINTPGSYQCTCPAGQGRLHWNGKDCTEPLKCQGSPGASKAMLSCNRSG
KKDTCALTCPSRARFLPESENGFTVSCGTPSPRAAPARAGHNGNSTNSNHCHEAAVLSIK
QRASFKIKDAKCRLHLRNKGKTEEAGRITGPGGAPCSECQVTFIHLKCDSSRKGKGRRAR
TPPGKEVTRLTLELEAEVRAEETTASCGLPCLRQRMERRLKGSLKMLRKSINQDRFLLRL
AGLDYELAHKPGLVAGERAEPMESCRPGQHRAGTKCVSCPQGTYYHGQTEQCVPCPAGTF
QEREGQLSCDLCPGSDAHGPLGATNVTTCAGQCPPGQHSVDGFKPCQPCPRGTYQPEAGR
TLCFPCGGGLTTKHEGAISFQDCDTKVQCSPGHYYNTSIHRCIRCAMGSYQPDFRQNFCS
RCPGNTSTDFDGSTSVAQCKNRQCGGELGEFTGYIESPNYPGNYPAGVECIWNINPPPKR
KILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFKT
SEANSARGFQIPYVTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKLIKAFFEVLAHPQ
NYFKYTEKHKEMLPKSFIKLLRSKVSSFLRPYK
NT seq 2982 nt   +upstreamnt  +downstreamnt
atgggctcggggcgcgtacccgggctctgcctgcttgtcctgctggtccacgcccgcgcc
gcccagtacagcaaagccgcgcaagatgtggatgagtgtgtggaggggactgacaactgc
cacatcgatgctatctgccagaacaccccgaggtcatacaagtgcatctgcaagtctggc
tacacaggggacggcaaacactgcaaagacgtggatgagtgcgagcgagaggataatgca
ggttgtgtgcatgactgtgtcaacatccctggcaattaccggtgtacctgctatgatgga
ttccacctggcacatgacggacacaactgtctggatgtggacgagtgtgccgagggcaac
ggcggctgtcagcagagctgtgtcaacatgatgggcagctatgagtgccactgccgggaa
ggcttcttcctcagcgacaaccagcatacctgtatccagcggccagaagaaggaatgaat
tgcatgaacaagaaccacggctgtgcccacatttgccgggagacacccaaggggggtatt
gcctgtgaatgccgtcctggctttgagcttaccaagaaccaacgggactgtaaattgaca
tgcaactatggtaacggcggctgccagcacacgtgtgatgacacagagcagggtccccgg
tgcggctgccatatcaagtttgtgctccataccgacgggaagacatgcatcgagacctgt
gctgtcaacaacgggggctgtgacagtaagtgccatgatgcagcgactggtgtccactgc
acctgccctgtgggcttcatgctgcagccagacaggaagacgtgcaaagatatagatgag
tgccgcttaaacaacgggggctgtgaccatatttgccgcaacacagtgggcagcttcgaa
tgcagttgcaagaaaggctataagcttctcatcaatgagaggaactgccaggatatagac
gagtgttcctttgatcgaacctgtgaccacatatgtgtcaacacaccaggaagcttccag
tgtctctgccatcgtggctacctgttgtatggtatcacccactgtggggatgtggatgaa
tgcagcatcaaccggggaggttgccgctttggctgcatcaacactcctggcagctaccag
tgtacctgcccagcaggccagggtcggctgcactggaatggcaaagattgcacagagcca
ctgaagtgtcagggcagtcctggggcctcgaaagccatgctcagctgcaaccggtctggc
aagaaggacacctgtgccctgacctgtccctccagggcccgatttttgccagagtctgag
aatggcttcacggtgagctgtgggacccccagccccagggctgctccagcccgagctggc
cacaatgggaacagcaccaactccaaccactgccatgaggctgcagtgctgtccattaaa
caacgggcctccttcaagatcaaggatgccaaatgccgtttgcacctgcgaaacaaaggc
aaaacagaggaggctggcagaatcacagggccaggtggtgccccctgctctgaatgccag
gtcaccttcatccaccttaagtgtgactcctctcggaagggcaagggccgacgggcccgg
acccctccaggcaaagaggtcacaaggctcaccctggaactggaggcagaggtcagagcc
gaagaaaccacagccagctgtgggctgccctgcctccgacagcgaatggaacggcggctg
aaaggatccctgaagatgctcagaaagtccatcaaccaggaccgcttcctgctgcgcctg
gcaggccttgattatgagctggcccacaagccgggcctggtagccggggagcgagcagag
ccgatggagtcctgtaggcccgggcagcaccgtgctgggaccaagtgtgtcagctgcccg
cagggaacgtattaccacggccagacggagcagtgtgtgccatgcccagcgggcaccttc
caggagagagaagggcagctctcctgcgacctttgccctgggagtgatgcccacgggcct
cttggagccaccaacgtcaccacgtgtgcaggtcagtgcccacctggccaacactctgta
gatgggttcaagccctgtcagccatgcccacgtggcacctaccaacctgaagcaggacgg
accctatgcttcccttgtggtgggggcctcaccaccaagcatgaaggggccatttccttc
caagactgtgacaccaaagtccagtgctccccagggcactactacaacaccagcatccac
cgctgtattcgctgtgccatgggctcctatcagcccgacttccgtcagaacttctgcagc
cgctgtccaggaaacacaagcacagactttgatggctctaccagtgtggcccaatgcaag
aatcgtcagtgtggtggggagctgggtgagttcactggctatattgagtcccccaactac
ccgggcaactacccagctggtgtggagtgcatctggaacatcaaccccccacccaagcgc
aagatccttatcgtggtaccagagatcttcctgccatctgaggatgagtgtggggacgtc
ctcgtcatgagaaagaactcatccccatcctccattaccacttatgagacctgccagacc
tacgagcgtcccattgccttcactgcccgttccaggaagctctggatcaacttcaagaca
agcgaggccaacagcgcccgtggcttccagattccctatgttacctatgatgaggactat
gagcagctggtagaagacattgtgcgagatggccggctctatgcctctgaaaaccaccag
gagattttaaaggacaagaagctcatcaaggccttctttgaggtgctagcccacccccag
aactacttcaagtacacagagaaacacaaggagatgctgccaaaatccttcatcaagctg
ctccgctccaaagtttccagcttcctgaggccctacaaatag

DBGET integrated database retrieval system