KEGG   Homo sapiens (human): 222962
Entry
222962            CDS       T01001                                 

Symbol
SLC29A4, ENT4, PMAT
Name
(RefSeq) solute carrier family 29 member 4
  KO
K03323  solute carrier family 29 (equilibrative nucleoside transporter), member 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    222962 (SLC29A4)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC29: Facilitative nucleoside transporter
   222962 (SLC29A4)
SSDB
Motif
Pfam: Nucleoside_tran CLN3
Other DBs
NCBI-GeneID: 222962
NCBI-ProteinID: NP_001035751
OMIM: 609149
HGNC: 23097
Ensembl: ENSG00000164638
Vega: OTTHUMG00000023797
Pharos: Q7RTT9(Tbio)
UniProt: Q7RTT9
Position
7p22.1
AA seq 530 aa
MGSVGSQRLEEPSVAGTPDPGVVMSFTFDSHQLEEAAEAAQGQGLRARGVPAFTDTTLDE
PVPDDRYHAIYFAMLLAGVGFLLPYNSFITDVDYLHHKYPGTSIVFDMSLTYILVALAAV
LLNNVLVERLTLHTRITAGYLLALGPLLFISICDVWLQLFSRDQAYAINLAAVGTVAFGC
TVQQSSFYGYTGMLPKRYTQGVMTGESTAGVMISLSRILTKLLLPDERASTLIFFLVSVA
LELLCFLLHLLVRRSRFVLFYTTRPRDSHRGRPGLGRGYGYRVHHDVVAGDVHFEHPAPA
LAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRALLLHRYVVARVIWADMLSI
AVTYFITLCLFPGLESEIRHCILGEWLPILIMAVFNLSDFVGKILAALPVDWRGTHLLAC
SCLRVVFIPLFILCVYPSGMPALRHPAWPCIFSLLMGISNGYFGSVPMILAAGKVSPKQR
ELAGNTMTVSYMSGLTLGSAVAYCTYSLTRDAHGSCLHASTANGSILAGL
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgggctccgtggggagccagcgccttgaggagcccagcgtggcaggcacaccagacccg
ggcgtagtgatgagcttcaccttcgacagtcaccagctggaggaggcggcggaggcggct
cagggccagggccttagggccaggggcgtcccagctttcacggatactacattggacgag
ccagtgcccgatgaccgttatcacgccatctactttgcgatgctgctggctggcgtgggc
ttcctgctgccatacaacagcttcatcacggacgtggactacctgcatcacaagtaccca
gggacctccatcgtgtttgacatgagcctcacctacatcttggtggcactggcagctgtc
ctcctgaacaacgtcctggtggagagactgaccctgcacaccaggatcaccgcaggctac
ctcttagccttgggccctctcctttttatcagcatctgcgacgtgtggctgcagctcttc
tctcgggaccaggcctacgccatcaacctggccgctgtgggcaccgtggccttcggctgc
acagtgcagcaatccagcttctacgggtacacggggatgctgcccaagcggtacacgcag
ggggtgatgaccggggagagcacggcgggcgtgatgatctctctgagccgcatcctcacg
aagctgctgctgcccgacgagcgcgccagcacgctcatcttcttcctggtgtcggtggcg
ctggagctgctgtgtttcctgctgcacctgttagtgcggcgcagccgcttcgtgctcttc
tataccacacggccgcgtgacagccaccggggcaggccaggcctgggcaggggctatggc
taccgcgtgcaccacgacgttgtcgccggggacgtccacttcgagcacccagccccggcc
ctggcccccaacgagtccccaaaggacagcccagcccacgaggtgaccggcagcggcggg
gcctacatgcgctttgatgtgccgcggccaagggtccagcgcagctggcccaccttcaga
gccctgttactgcaccgctacgtggtggcgcgggtgatctgggccgacatgctctccatc
gccgtgacctacttcatcacgctgtgcctgttccccggcctcgagtctgagatccgccac
tgcatcctgggcgagtggctgcccatcctcatcatggctgtgttcaacctgtcagacttc
gtgggcaagatcctggcagccctgcccgtggactggcggggcacccacctgctggcctgc
tcctgcctgcgtgtggtcttcatccccctcttcatcctgtgcgtctaccccagcggcatg
cccgccctccgtcaccccgcctggccctgcatcttctcactgctcatgggcatcagcaac
ggctacttcggcagcgtgcccatgatcctggcggcaggcaaagtgagccccaagcagcgg
gagctggcagggaacaccatgaccgtgtcctacatgtcagggctgacgctggggtccgcc
gtggcctactgcacctacagcctcacccgcgacgctcacggcagctgcctgcacgcctcc
accgccaatggttccatcctcgcaggcctctga

DBGET integrated database retrieval system