KEGG   Homo sapiens (human): 222967Help
Entry
222967            CDS       T01001                                 

Gene name
RSPH10B
Definition
(RefSeq) radial spoke head 10 homolog B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: MORN
Motif
Other DBs
NCBI-GeneID: 222967
NCBI-ProteinID: NP_775836
HGNC: 27362
Ensembl: ENSG00000155026
Vega: OTTHUMG00000152378
UniProt: B2RC85
Position
7p22.1
AA seq 870 aa AA seqDB search
MVKEKKKADKKGEKSARSPSSLSDNLDFSKQDGNTTRQEMSPAGVPLLGMQLNEVKPKKD
RQNVQQNEDATQYEESILTKLIVESYEGEKVRGLYEGEGFAAFQGGCTYRGMFSEGLMHG
QGTYIWADGLKYEGDFVKNVPMNHGVYTWPDGSMYEGEVVNGMRNGFGMFKCSTQPVSYI
GHWCNGKRHGKGSIYYNQEGTCWYEGDWVQNIKKGWGIRCYKSGNIYEGQWEDNMRHGEG
RMRWLTTNEEYTGRWERGIQNGFGTHTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFY
YASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSNDHIAGFPDLEVEFISCLDLSSGVA
PRLSRSAELIRKLDGSESHSVLGSSIELDLNLLLDMYPETVQPEEKKQVEYAVLRNITEL
RRIYSFYSSLGCGHSLDNTFLMTKLHFWRFLKDCKFHHHKLTLADMDRILSANNDIPVEE
IHSPFTTILLRTFLNYLLHLAYHIYHEEFQKRSPSLFLCFTKLMTENIRPNACQIKGNLF
REQQRTLYSMSYMNKCWEIYLAYCRPSAAPPHEPTMKMRHFLWMLKDFKMINKELTAATF
MEVIAEDNRFIYDGIDSNFEPELVFLEFFEALLSFAFICVTDQMTKSYTNVPADDVSGNK
HETIYTILNQDAQNKSPSAVMSHESDAAHSDSARSSSSKLELSPDVNKIRKSEPKIKKSV
SHERVSKMNFKLTGKGITFFSSESKKYERPKDDREEEFNTWVNNMYVFFVNTLFHAYKRE
EAIKEKIRADRLRSTAQAQQRKMEDDELEARLNIFILREEEAKRHDYEVDITVLKEPADV
SSSHLILDPPKEDVTVSPSSKTITSKKKKK
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaagaaaagaaaaaagcagacaaaaaaggggagaagtctgcccgctctccctca
tctctctctgataatctagacttttccaaacaagatggcaacaccactaggcaagagatg
tccccagctggtgtcccattgctgggaatgcagctcaacgaagtgaaacccaaaaaagac
cgccaaaacgttcagcagaacgaagatgccacccaatacgaagagtccattctgaccaaa
ctcatagtggaaagctatgaaggggaaaaggttcgtgggctgtatgagggagaaggcttc
gcagcctttcaaggcggttgtacctatcgtggtatgttttcagaaggactcatgcatgga
caggggacttatatttgggccgatggattaaaatatgagggcgactttgtgaagaatgtc
ccgatgaaccacggcgtgtacacgtggccggacggcagcatgtatgaaggcgaagtggtc
aacggcatgaggaacggattcgggatgttcaagtgcagcacccagcctgtgtcctacatc
ggccactggtgcaatggcaagcggcacgggaagggctccatttattacaatcaagagggt
acgtgttggtacgagggagactgggtacaaaacatcaaaaagggctggggaataagatgt
tataaatctggaaatatatacgaaggccagtgggaagacaacatgcgccacggggagggg
aggatgaggtggctgaccaccaacgaagagtacaccgggcggtgggagaggggcatccag
aatggctttggaacacacacatggtttctaaagagaatccgcagttcccagtatcctttg
agaaatgaatacataggggagtttgtaaatggatatcgtcacggacgtggcaagttttat
tatgccagtggagccatgtatgatggagaatgggtttccaataagaaacatggcatgggc
cgattaactttcaagaacgggcgtgtgtacgaaggcgcattctccaatgaccacatagct
gggtttccggatcttgaagttgaattcatcagctgcctggacctgtcttcaggagttgcc
ccaagactgtccaggagcgccgaactgatcagaaagcttgatggcagtgaaagtcattct
gtgttgggatcgagcattgagctggatctaaatttgctcctggacatgtaccctgagaca
gtccaacctgaagaaaagaagcaggtggaatatgccgtcttaagaaatattacagaatta
agaagaatttacagcttttacagcagcctgggatgcggccactctctggataataccttt
ctgatgacaaagcttcacttctggagatttctaaaagattgcaaatttcatcaccacaaa
ctaactcttgctgatatggacaggatattaagtgccaataatgacataccagttgaagaa
atccattctccatttacaacaatacttttgagaacatttttgaattacctcctgcatttg
gcgtaccacatttatcatgaagaattccaaaagagaagcccatccctcttcttgtgtttt
acaaaactgatgaccgagaacattcgtccaaatgcctgccagataaaaggcaatttattc
cgtgagcaacagcggacgctctactctatgagttacatgaataagtgctgggagatttat
ctcgcttactgcagacccagtgcagcgcctccccacgagcctacgatgaagatgagacac
ttcctctggatgctgaaagactttaaaatgataaataaagaattaacagcagctacattt
atggaggtcatagcagaggataatcgtttcatatatgatggaattgacagcaactttgaa
cctgagctggttttcctggaattctttgaagctctcttaagctttgcattcatctgtgtt
actgaccaaatgactaaatcctatacaaatgttccagctgatgatgtgtctggaaataaa
catgaaactatttatacaatactaaatcaggacgcccagaacaagagtcccagcgcggtc
atgagccacgaatcggatgctgctcactctgacagtgccaggtcatcttccagcaagtta
gaactctcgcctgatgttaacaaaataaggaaatcagagcccaagatcaagaagtctgta
agtcatgaaagagtctccaaaatgaattttaaattgactggaaaagggatcacctttttc
tcatctgagagcaagaaatatgagagacccaaggatgatcgagaggaagagttcaacacg
tgggtcaataatatgtacgtcttctttgtgaacacgctctttcatgcgtataaacgtgaa
gaagctatcaaggagaaaataagggcagacaggttacgtagcacagcacaggcccagcag
cggaagatggaagatgacgaactggaagcaaggctgaacatcttcatcttgagagaggaa
gaggccaagagacatgactatgaggtggacatcacagtgctcaaggagccggcagacgtg
tcatcctctcacctcatactggaccctcccaaggaggatgtgaccgtgtccccatccagc
aagaccatcaccagcaagaagaagaaaaagtag

DBGET integrated database retrieval system