KEGG   Homo sapiens (human): 223Help
Entry
223               CDS       T01001                                 

Gene name
ALDH9A1, ALDH4, ALDH7, ALDH9, E3, TMABADH
Definition
(RefSeq) aldehyde dehydrogenase 9 family member A1
  KO
K00149  aldehyde dehydrogenase family 9 member A1 [EC:1.2.1.47 1.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00053  Ascorbate and aldarate metabolism
hsa00071  Fatty acid degradation
hsa00280  Valine, leucine and isoleucine degradation
hsa00310  Lysine degradation
hsa00330  Arginine and proline metabolism
hsa00340  Histidine metabolism
hsa00380  Tryptophan metabolism
hsa00410  beta-Alanine metabolism
hsa00561  Glycerolipid metabolism
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
Module
hsa_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    223 (ALDH9A1)
   00053 Ascorbate and aldarate metabolism
    223 (ALDH9A1)
   00620 Pyruvate metabolism
    223 (ALDH9A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    223 (ALDH9A1)
   00561 Glycerolipid metabolism
    223 (ALDH9A1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    223 (ALDH9A1)
   00310 Lysine degradation
    223 (ALDH9A1)
   00330 Arginine and proline metabolism
    223 (ALDH9A1)
   00340 Histidine metabolism
    223 (ALDH9A1)
   00380 Tryptophan metabolism
    223 (ALDH9A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    223 (ALDH9A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     223 (ALDH9A1)
    1.2.1.47  4-trimethylammoniobutyraldehyde dehydrogenase
     223 (ALDH9A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 223
NCBI-ProteinID: NP_000687
OMIM: 602733
HGNC: 412
Ensembl: ENSG00000143149
Vega: OTTHUMG00000034677
Pharos: P49189(Tbio)
UniProt: P49189
Structure
PDB: 

Position
1q24.1
AA seq 518 aa AA seqDB search
MFLRAGLAALSPLLRSLRPSPVAAMSTGTFVVSQPLNYRGGARVEPADASGTEKAFEPAT
GRVIATFTCSGEKEVNLAVQNAKAAFKIWSQKSGMERCRILLEAARIIREREDEIATMEC
INNGKSIFEARLDIDISWQCLEYYAGLAASMAGEHIQLPGGSFGYTRREPLGVCVGIGAW
NYPFQIASWKSAPALACGNAMVFKPSPFTPVSALLLAEIYSEAGVPPGLFNVVQGGAATG
QFLCQHPDVAKVSFTGSVPTGMKIMEMSAKGIKPVTLELGGKSPLIIFSDCDMNNAVKGA
LMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHL
ERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPV
MSILSFDTEAEVLERANDTTFGLAAGVFTRDIQRAHRVVAELQAGTCFINNYNVSPVELP
FGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDVESAF
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtttctccgagcaggcctggccgcgctctccccgcttcttcgcagtcttcggccctct
cctgtcgccgccatgagcactggcaccttcgtcgtgtcgcagccgctcaattaccgcggc
ggggcccgcgtggagccggcggacgcctccggtaccgagaaagctttcgagccagcaacc
ggccgagtgatagctactttcacatgttcaggagaaaaggaagtaaatttggctgttcaa
aatgcaaaggctgcttttaaaatatggagtcaaaaatctggcatggagcgttgccgaatc
cttttggaggctgccaggataataagggaacgggaggatgaaattgctactatggagtgc
atcaacaatggcaagtccatctttgaggcccgcttggacattgacatttcctggcagtgc
ctggagtattatgcgggcttggctgcatccatggctggtgaacacatccagctcccaggt
ggatcgtttggttataccagaagagaaccacttggggtatgtgtgggaataggagcatgg
aactacccctttcagattgcctcttggaagtcggctccagcattagcctgtggtaatgcc
atggtctttaaaccttctccctttacacctgtttctgcattgctactggctgaaatctac
agtgaggctggtgtacctcctgggctcttcaatgtggtgcagggaggggctgccacaggc
cagtttctgtgtcagcatcccgatgtggccaaagtctccttcactggaagtgtgcccact
ggcatgaagatcatggagatgtcagctaaaggaatcaaacctgttaccttggaacttgga
ggcaaatctccactcatcatcttctcagactgtgatatgaacaatgctgtaaagggggcg
ctgatggccaacttcctcacacaaggccaggtttgctgtaatggcacaagagtatttgtg
cagaaagaaattcttgataaatttacagaggaagtggtgaaacagacccaaaggattaaa
attggagatccccttctggaagatacaaggatgggtccactcatcaaccgaccacacctg
gagcgagtccttgggtttgtcaaagtggcaaaggagcagggtgctaaagtgttatgtggt
ggagatatatatgtacctgaagatcccaaattaaaggatggatattacatgagaccttgt
gtattaactaattgcagagacgacatgacctgtgtgaaggaagagatctttgggcctgtt
atgtccattttatcatttgacactgaagctgaggttctagaaagagccaatgataccact
tttggactagcagctggcgtctttaccagggacatccaacgggctcatagagtggtagct
gagcttcaggctgggacgtgcttcattaacaactataacgtcagcccagtggagttgccc
tttggtggatataagaagtcaggatttggcagagagaacggccgtgtgacaatcgaatat
tattcacagctgaagactgtgtgtgtggagatgggtgatgtggaatctgctttttga

DBGET integrated database retrieval system