KEGG   Homo sapiens (human): 2230Help
Entry
2230              CDS       T01001                                 

Gene name
FDX1, ADX, FDX, LOH11CR1D
Definition
(RefSeq) ferredoxin 1
  KO
K22070  ferredoxin-1, mitochondrial
Organism
hsa  Homo sapiens (human)
Brite
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    2230 (FDX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2
Motif
Other DBs
NCBI-GeneID: 2230
NCBI-ProteinID: NP_004100
OMIM: 103260
HGNC: 3638
Ensembl: ENSG00000137714
Vega: OTTHUMG00000166589
Pharos: P10109(Tbio)
UniProt: P10109
Structure
PDB: 

Position
11q22.3
AA seq 184 aa AA seqDB search
MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARAR
SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFE
DHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDV
GKTS
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgctgggggcgcccggctgctgcgcgccgcttctgctgtcctcggcggcccg
gccggccggtggctgcaccacgctgggtcccgcgctggatccagcggcctgctgaggaac
cgggggccgggcgggagcgcggaggcgagccggtcgctgagcgtgtcggcgcgggcccgg
agcagctcagaagataaaataacagtccactttataaaccgtgatggtgaaacattaaca
accaaaggaaaagttggtgattctctgctagatgttgtggttgaaaataatctagatatt
gatggctttggtgcatgtgagggaaccctggcttgttcaacctgtcacctcatctttgaa
gatcacatatatgagaagttagatgcaatcactgatgaggagaatgacatgctcgatctg
gcatatggactaacagacagatcacggttgggctgccaaatctgtttgacaaaatctatg
gacaatatgactgttcgagtgcctgaaacagtggctgatgccagacaatccattgatgtg
ggcaagacctcctga

DBGET integrated database retrieval system