KEGG   Homo sapiens (human): 223075
Entry
223075            CDS       T01001                                 
Symbol
ITPRID1, CCDC129
Name
(RefSeq) ITPR interacting domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: KRAP_IP3R_bind SSFA2_C CCDC90-like Lectin_N
Other DBs
NCBI-GeneID: 223075
NCBI-ProteinID: NP_001244896
HGNC: 27363
Ensembl: ENSG00000180347
Pharos: Q6ZRS4(Tdark)
UniProt: Q6ZRS4 A0A087WUB1
Position
7:31514090..31658720
AA seq 1044 aa
MMAQKSQGSDNLQEGQEKSKREILKCTKSAWAPLDEWLPPDPEEESQSLTIPMLEDSKQE
SIQQWLDSGFFVSANENFQQVIDRTVSLYEQGMVQMTVKDYMRSLHQFSETPILSRGTSF
NSCYSTASVPQSIPEWLEFWEIDPVEILLDLGFGADEPDICMQIPARFLGCGSAARGINI
RVFLEAQKQRMDIENPNLYGRFRQLEILDHVTNAFSSLLSDVSILPNRAEEKAGGESVQR
TSVSAAKEHRRRMGKLLRRASKQNIRRDCNPEVSESFKVKDEVFVPFTKPWDCGAELAAT
SINHKQNHLSLSVEHQSLQACDDLLPYPPHGLLSKQWPCSSMPAKQAPPSCVSEGSVKGR
TQKENLFQTNKLKSLSHLAGKGPDSFEMEEVQSFEEETGNPLDMTSGTVGARVDRANSCQ
SDSSGFLEEPLEPLPLQMPSLPNSQSPAENGGRKPRDQSHSLVSSQDCQLESDGPDSKSR
ASMSFSSQEANALEQRASVSVMEEEFLLEAMEGPPELYIPDMACAKTTTRGECPRKDSHL
WQLLPMPHAEYEVTRPTATSKYDHPLGFMVTHVTEMQDSFVRPEGAGKVQSHHNESQRSP
GNDHTQDKFLHVDSEAPREEESSGFCPHTNHSLLVPESSSQCIPKHSEITPYATDLAQTS
EKLIPHLHKLPGDPAQVKSRSGTLGQILPGTEAEMENLPLNTGSSRSVMTQMSSSLVSAA
QRAVALGTGPRGTSLECTVCDPVTATETRLGTKARQLNDASIQTSALSNKTLTHGPQPLT
KSVSLDSGFSSICPMGTCHAIPAHCCICCHHHPHCHGERQSPGPEPSVCRHCLCSLTGHQ
EAQFMTTLKALQDTTVRELCSCTVHEMEAMKTICQSFREYLEEIEQHLMGQQALFSRDMS
EEEREEAEQLQTLREALRQQVAELEFQLGDRAQQIREGILLQLEVLTAEPPEHYSNLHQY
NWIEESNGQTSCSKIHPGMAPRTVFPPDDGQEAPCSGGTQLAAFTPPTLENSTRMSPSSS
AWAKLGPTPLSNCPVGEKDADVFL
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgatggcacagaaatcacaaggatctgacaaccttcaggaaggccaggaaaagagcaag
agagagatcctgaagtgcaccaaaagcgcgtgggctccgctggatgagtggctgccccct
gaccctgaggaggaaagccagagtctcaccatccccatgctggaagattccaagcaagaa
agtattcagcagtggctggactctggattctttgtctctgcaaatgaaaactttcaacaa
gtcattgaccgcactgtttctttgtatgaacaagggatggttcaaatgactgtgaaagac
tacatgagatctttgcatcagttttcagaaactcccatcctatccagagggaccagtttc
aactcttgctattctactgcaagtgtaccacaaagcattcctgaatggctggaattttgg
gagatagatccagtggagattctcttggatctggggtttggtgctgatgagccagacatc
tgcatgcaaatcccagccagattccttggttgtggctcagcagccagaggaatcaacatc
cgtgtttttcttgaagctcaaaagcagcgaatggacattgagaaccccaacttgtacggt
cgtttccgacagctggaaatcctggaccatgtgaccaatgccttctcatctctgctgagt
gatgtcagcatcctgccaaacagagctgaagagaaagctggaggagagagtgtgcaaaga
acctcagtgagtgccgccaaagagcatcgaagaagaatgggtaaactcttaaggagagct
tccaaacagaacatcaggcgggattgtaacccagaggtatcagagtccttcaaggtgaag
gatgaagtttttgttccctttacaaaaccatgggattgtggagcagagctagcagcaacc
tcaatcaaccacaagcaaaatcatttgtctctgtcagtagaacatcagtctctccaagcc
tgtgatgatttgctaccttatcctcctcatggtcttctgagcaagcagtggccttgctca
tctatgccggccaagcaggctcctccttcctgtgtgtctgaggggtcagtcaagggcaga
actcagaaggagaacttatttcagactaacaagctcaagagcttgtctcatcttgcaggc
aaaggaccagactcatttgaaatggaagaggtccaaagctttgaagaagagactggtaat
cctcttgacatgacttcaggaactgtaggtgccagggtggacagagcaaatagctgccag
tctgacagcagcgggttcctggaggagccgctggaaccgctgcccctccagatgccttcc
ttgccaaacagccagagtcctgctgagaatggaggtagaaagccaagagatcagagccac
agcttagtatcatcccaggactgtcagctagagtcggatgggccagattccaaaagtagg
gcgagcatgtctttttcaagccaagaagcgaatgccttggaacaaagggcctcagtatct
gtgatggaggaagagtttctgcttgaggccatggaggggccaccagagctgtatatccca
gacatggcctgtgccaagaccaccacgaggggagaatgcccaaggaaagacagccatctg
tggcagcttctgccaatgccccatgctgagtatgaggtcaccagacccacagccacttcc
aaatatgatcatcctctggggtttatggtaacccacgtcacagaaatgcaggacagtttt
gtgaggcctgagggagctggcaaagtgcaaagccaccacaatgagtctcaaaggtcacct
ggaaatgatcatactcaagacaagttccttcatgttgactctgaggccccacgagaagag
gaaagcagtggattctgtcctcacaccaaccacagcttactcgtaccagaaagctcatca
cagtgtatccccaagcacagtgaaatcacaccttatgcaactgaccttgctcaaacatct
gaaaagctcattccccacctccataaactgcctggagatcctgcccaggtgaagtcaagg
tctggtactttgggtcagatactacctgggacagaagctgagatggaaaaccttcctcta
aatactggcagctccaggtctgtaatgacccagatgtcctccagcctggtgtcggctgct
cagagggctgtggccttggggactggtcccagaggaacatctttagaatgcactgtgtgt
gatcctgttaccgcaacagaaacaagactggggacaaaagcaagacagttaaatgatgct
tccattcagacttcagctctaagcaacaagaccttgacacatgggccccagcccctcacc
aaatccgtctctctagactcaggcttctctagtatctgcccaatgggcacctgccatgct
atacctgcccactgctgcatctgctgtcatcaccaccctcactgccacggggagaggcaa
agccctggccctgaaccctcagtctgtaggcactgcctgtgttcactaactggtcaccag
gaagcccagttcatgacgactttgaaagcccttcaggacactacagtgagggagctatgt
tcctgcacagtccatgagatggaagccatgaagacgatatgccaaagtttccgggagtat
ttagaagaaattgaacagcaccttatgggacagcaggccctcttttccagggacatgtca
gaggaggaaagggaggaggccgagcaactgcaaacgttacgtgaggccctgaggcagcag
gtggcagagttggaatttcagttaggagaccgggctcagcaaatcagagaagggatttta
ctgcagctggaggttctcacagcagagccacctgaacactattcaaatctgcatcaatat
aactggatagaagaaagcaatgggcagacttcatgttctaaaatccacccaggcatggcc
ccgaggactgtgtttcctcccgatgatggccaggaggctccctgttcaggtgggacccag
ttggctgccttcactccacccaccttggagaacagcaccaggatgtctccttcatcatca
gcttgggcaaagttaggtccaacccctttgtcaaattgtcctgttggagaaaaggatgca
gatgtcttcctctag

DBGET integrated database retrieval system