KEGG   Homo sapiens (human): 223117Help
Entry
223117            CDS       T01001                                 

Gene name
SEMA3D, Sema-Z2, coll-2
Definition
(RefSeq) semaphorin 3D
  KO
K06840  semaphorin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    223117 (SEMA3D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sema Ig_3 Ig_6 V-set PSI I-set ig Ig_2
Motif
Other DBs
NCBI-GeneID: 223117
NCBI-ProteinID: NP_689967
OMIM: 609907
HGNC: 10726
Ensembl: ENSG00000153993
Vega: OTTHUMG00000154569
Pharos: O95025(Tbio)
UniProt: O95025
Position
7q21.11
AA seq 777 aa AA seqDB search
MNANKDERLKARSQDFHLFPALMMLSMTMLFLPVTGTLKQNIPRLKLTYKDLLLSNSCIP
FLGSSEGLDFQTLLLDEERGRLLLGAKDHIFLLSLVDLNKNFKKIYWPAAKERVELCKLA
GKDANTECANFIRVLQPYNKTHIYVCGTGAFHPICGYIDLGVYKEDIIFKLDTHNLESGR
LKCPFDPQQPFASVMTDEYLYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNG
AKFIGTFFIPDTYNPDDDKIYFFFRESSQEGSTSDKTILSRVGRVCKNDVGGQRSLINKW
TTFLKARLICSIPGSDGADTYFDELQDIYLLPTRDERNPVVYGVFTTTSSIFKGSAVCVY
SMADIRAVFNGPYAHKESADHRWVQYDGRIPYPRPGTCPSKTYDPLIKSTRDFPDDVISF
IKRHSVMYKSVYPVAGGPTFKRINVDYRLTQIVVDHVIAEDGQYDVMFLGTDIGTVLKVV
SISKEKWNMEEVVLEELQIFKHSSIILNMELSLKQQQLYIGSRDGLVQLSLHRCDTYGKA
CADCCLARDPYCAWDGNACSRYAPTSKRRARRQDVKYGDPITQCWDIEDSISHETADEKV
IFGIEFNSTFLECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
GMYYCKAQEHTFIHTIVKLTLNVIENEQMENTQRAEHEEGKVKDLLAESRLRYKDYIQIL
SSPNFSLDQYCEQMWHREKRRQRNKGGPKWKHMQEMKKKRNRRHHRDLDELPRAVAT
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctaataaagatgaaagacttaaagccagaagccaagattttcacctttttcct
gctttgatgatgctaagcatgaccatgttgtttcttccagtcactggcactttgaagcaa
aatattccaagactcaagctaacctacaaagacttgctgctttcaaatagctgtattccc
tttttgggttcatcagaaggactggattttcaaactcttctcttagatgaggaaagaggc
aggctgctcttgggagccaaagaccacatctttctactcagtctggttgacttaaacaaa
aattttaagaagatttattggcctgctgcaaaggaacgggtggaattatgtaaattagct
gggaaagatgccaatacagaatgtgcaaatttcatcagagtacttcagccctataacaaa
actcacatatatgtgtgtggaactggagcatttcatccaatatgtgggtatattgatctt
ggagtctacaaggaggatattatattcaaactagacacacataatttggagtctggcaga
ctgaaatgtcctttcgatcctcagcagccttttgcttcagtaatgacagatgagtacctc
tactctggaacagcttctgatttccttggcaaagatactgcattcactcgatcccttggg
cctactcatgaccaccactacatcagaactgacatttcagagcactactggctcaatgga
gcaaaatttattggaactttcttcataccagacacctacaatccagatgatgataaaata
tatttcttctttcgtgaatcatctcaagaaggcagtacctccgataaaaccatcctttct
cgagttggaagagtttgtaagaatgatgtaggaggacaacgcagcctgataaacaagtgg
acgacttttcttaaggccagactgatttgctcaattcctggaagtgatggggcagatact
tactttgatgagcttcaagatatttatttactccccacaagagatgaaagaaatcctgta
gtatatggagtctttactacaaccagctccatcttcaaaggctctgctgtttgtgtgtat
agcatggctgacatcagagcagtttttaatggtccatatgctcataaggaaagtgcagac
catcgttgggtgcagtatgatgggagaattccttatccacggcctggtacatgtccaagc
aaaacctatgacccactgattaagtccacccgagattttccagatgatgtcatcagtttc
ataaagcggcactctgtgatgtataagtccgtatacccagttgcaggaggaccaacgttc
aagagaatcaatgtggattacagactgacacagatagtggtggatcatgtcattgcagaa
gatggccagtacgatgtaatgtttcttggaacagacattggaactgtcctcaaagttgtc
agcatttcaaaggaaaagtggaatatggaagaggtagtgctggaggagttgcagatattc
aagcactcatcaatcatcttgaacatggaattgtctctgaagcagcaacaattgtacatt
ggttcccgagatggattggttcagctctccttgcacagatgcgacacttatgggaaagct
tgcgcagactgttgtcttgccagagacccctactgtgcctgggatggaaatgcatgctct
cgatatgctcctacttctaaaaggagagctagacgccaagatgtaaaatatggcgaccca
atcacccagtgctgggacatcgaagacagcattagtcatgaaactgctgatgaaaaggtg
atttttggcattgaatttaactcaacctttctggaatgtatacctaaatcccaacaagca
actattaaatggtatatccagaggtcaggggatgagcatcgagaggagttgaagcccgat
gaaagaatcatcaaaacggaatatgggctactgattcgaagtttgcagaagaaggattct
gggatgtattactgcaaagcccaggagcacactttcatccacaccatagtgaagctgact
ttgaatgtcattgagaatgaacagatggaaaatacccagagggcagagcatgaggagggg
aaggtcaaggatctattggctgagtcacggttgagatacaaagactacatccaaatcctt
agcagcccaaacttcagcctcgaccagtactgcgaacagatgtggcacagggagaagcgg
agacagagaaacaaggggggcccaaagtggaagcacatgcaggaaatgaagaagaaacga
aatcgaagacatcacagagacctggatgagctccctagagctgtagccacgtag

DBGET integrated database retrieval system